skin & body skin care

(66 Items)

51068 921138 921138 1 Balancing Mask TESTER 0.5 Fl. Oz. HydroPeptide HydroPeptide Balancing Mask TESTER 0.5 Fl. Oz. False hydropeptide/hydropeptidebalancingmask.jpg Special Offer Available 19.00 19.00 8.00 True True False False 8.00 False False Diversion contract is required HydroPeptide Balancing Mask is a creamy clay-based age-defying mask that strengthens skin against environmental stressors and infuses it with the protective nutrients it needs to stay balanced, calm, hydrated, and youthful-looking. True Log in to view pricing. False

HydroPeptide
Balancing Mask TESTER

0.5 Fl. Oz.

SKU 921138

Promotional ItemLog in to view pricing.
Quick View
160592 921486 921486 1 Barrier Builder TESTER 1.7 Fl. Oz. HydroPeptide HydroPeptide Barrier Builder TESTER 1.7 Fl. Oz. False hydropeptide/hydropeptidebarrierbuilder1.7oz.jpg Special Offer Available 24.00 24.00 8.00 True True False False 8.00 False False Diversion contract is required HydroPeptide Barrier Builder is a rich therapeutic cream that provides intensive moisture and nourishment to powerfully renew, repair, and reduce inflammation. False Log in to view pricing. False

HydroPeptide
Barrier Builder TESTER

1.7 Fl. Oz.

SKU 921486

Promotional ItemLog in to view pricing.
Quick View
157985 921480 921480 1 Clear Rescue Serum 1 Fl. Oz. HydroPeptide HydroPeptide Clear Rescue Serum 1 Fl. Oz. True hydropeptide/newhypclearrescue1oz.jpg Special Offer Available 42.00 42.00 42.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Clear Rescue Serum is a skin-refining serum that takes a multi-functional approach to pre-, post-, and active acne concerns. False Log in to view pricing. False

HydroPeptide
Clear Rescue Serum

Promotional ItemLog in to view pricing.
View Sizes
73734 921147 921147 1 Firm-a-Fix Neck Nectar TESTER 1.7 Fl. Oz. HydroPeptide HydroPeptide Firm-a-Fix Neck Nectar TESTER 1.7 Fl. Oz. False hydropeptide/nd18hydropeptidefirmafixnectar.jpg Special Offer Available 48.00 48.00 10.00 True True False False 10.00 False False Diversion contract is required HydroPeptide Firma-Fix Neck Nectar is designed specifically for use on your neck and décolleté. False Log in to view pricing. False

HydroPeptide
Firm-a-Fix Neck Nectar TESTER

1.7 Fl. Oz.

SKU 921147

Promotional ItemLog in to view pricing.
Quick View
175452 921428 921428 1 Liquid Resurfacing Solution TESTER 4 Fl. Oz. HydroPeptide HydroPeptide Liquid Resurfacing Solution TESTER 4 Fl. Oz. False hydropeptide/liquidresufacingsolution4oztester.jpg Special Offer Available 20.00 20.00 5.00 True True False False 5.00 False False Diversion contract is required HydroPeptide Liquid Resurfacing Solution is a lightweight, leave-on exfoliant that partners 2% salicylic acid and potent antioxidants with patented CellRenew-16 technology to visibly improve skin tone and texture without compromising the skin's moisture barrier. True Log in to view pricing. False

HydroPeptide
Liquid Resurfacing Solution TESTER

4 Fl. Oz.

SKU 921428

Promotional ItemLog in to view pricing.
Quick View
50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

HydroPeptide
Nimni Day Cream

1 Fl. Oz.

SKU 921552

Promotional ItemLog in to view pricing.
Quick View
51065 920258 920258 1 Radiance Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Radiance Mask 0.5 Fl. Oz. False hydropeptide/hpradiancemask.jpg Special Offer Available 24.00 24.00 14.40 True True False False 14.40 False False Diversion contract is required HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. False Log in to view pricing. False

HydroPeptide
Radiance Mask

0.5 Fl. Oz.

SKU 920258

Promotional ItemLog in to view pricing.
Quick View
51071 921137 921137 1 Rejuvenating Mask TESTER 0.5 Fl. Oz. HydroPeptide HydroPeptide Rejuvenating Mask TESTER 0.5 Fl. Oz. False hydropeptide/hprejuvenatingmask.jpg Special Offer Available 19.00 19.00 8.00 True True False False 8.00 False False Diversion contract is required HydroPeptide Rejuvenating Mask is a calming, detoxifying mask that will pamper and restore sensitive or sensitized skin with cool, purifying clays and calming peptides True Log in to view pricing. False

HydroPeptide
Rejuvenating Mask TESTER

0.5 Fl. Oz.

SKU 921137

Promotional ItemLog in to view pricing.
Quick View
144010 921410 921410 1 Retinol Routine Booster TESTER 1.01 Fl. Oz. HydroPeptide HydroPeptide Retinol Routine Booster TESTER 1.01 Fl. Oz. False noimage.png Special Offer Available 40.00 40.00 10.00 True True False False 10.00 False False Diversion contract is required HydroPeptide Retinol Routine Booster is formulated with an exclusive, patented Cellnew-16 peptide and 1% Universal Tri-Retinol Complex. False Log in to view pricing. False

HydroPeptide
Retinol Routine Booster TESTER

1.01 Fl. Oz.

SKU 921410

Promotional ItemLog in to view pricing.
Quick View
40098 921131 921131 1 Solar Defense Body TESTER 6 Fl. Oz. HydroPeptide HydroPeptide Solar Defense Body TESTER 6 Fl. Oz. False hydropeptide/solardefensebodyretail.jpg Special Offer Available 19.00 19.00 8.00 True True False False 8.00 False False Diversion contract is required HydroPeptide Solar Defense Body is a broad spectrum SPF 40 spray. False Log in to view pricing. False

HydroPeptide
Solar Defense Body TESTER

6 Fl. Oz.

SKU 921131

Promotional ItemLog in to view pricing.
Quick View
40050 921129 921129 1 Solar Defense Tinted Moisturizer TESTER 1.7 Fl. Oz. HydroPeptide HydroPeptide Solar Defense Tinted Moisturizer TESTER 1.7 Fl. Oz. False hydropeptide/hydropeptide_solar_defense_tinted.jpg Special Offer Available 21.00 21.00 10.00 True True False False 10.00 False False Diversion contract is required HydroPeptide Solar Defense Tinted Moisturizer is a self-adjusting tinted SPF that adapts instantly to most skin tones, providing a healthy glow and broad-spectrum mineral protection from UVA, UVB, and infrared rays. False Log in to view pricing. False

HydroPeptide
Solar Defense Tinted Moisturizer TESTER

1.7 Fl. Oz.

SKU 921129

Promotional ItemLog in to view pricing.
Quick View
156543 921477 921477 1 Solar Dew TESTER 1.35 Fl. Oz. HydroPeptide HydroPeptide Solar Dew TESTER 1.35 Fl. Oz. False hydropeptide/hydropeptidesolardew.jpg Special Offer Available 27.00 27.00 8.00 True True False False 8.00 False False Diversion contract is required Hydropeptide Solar Dew is a luxe, lightweight sun serum that melts effortlessly into skin for fast-absorbing, moisturizing 100% mineral protection with zero white cast. True Log in to view pricing. False

HydroPeptide
Solar Dew TESTER

1.35 Fl. Oz.

SKU 921477

Promotional ItemLog in to view pricing.
Quick View
90828 921313 921313 1 Vital Eyes TESTER 0.3 Fl. Oz. HydroPeptide HydroPeptide Vital Eyes TESTER 0.3 Fl. Oz. False hydropeptide/hydropeptidevitaleyes03floz.jpg Special Offer Available 45.00 45.00 10.00 True True False False 10.00 False False Diversion contract is required HydroPeptide Vital Eyes Instant Awakening Serum is formulated with antioxidants and peptides and is designed to target the appearance of fine lines, wrinkles, puffiness, and discoloration without irritation. False Log in to view pricing. False

HydroPeptide
Vital Eyes TESTER

0.3 Fl. Oz.

SKU 921313

Promotional ItemLog in to view pricing.
Quick View
39411 920119 920119 1 5X Power Peel 30 pk. HydroPeptide HydroPeptide 5X Power Peel 30 pk. False hydropeptide/HydroP5xPowerPeelUpdate25.jpg Special Offer Available 36.50 36.50 36.50 False False False False 0.00 False False Diversion contract is required Hydropeptide 5X Power Peel resurfaces, clarifies, brightens, and smooths away the appearance of wrinkles with five powerful daily exfoliants. True Log in to view pricing. False

HydroPeptide
5X Power Peel

30 pk.

SKU 920119

Log in to view pricing.
Quick View
70656 920149 920149 1 Hydraflora Probiotic Essence 4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydraflora Probiotic Essence 4 Fl. Oz. False hydropeptide/hypnewhydraflora4oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydraflora Probiotic Essence Toner is formulated with a powerful pre- and probiotic complex to help maintain healthy microflora and provide skin barrier support. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Hydraflora Probiotic Essence

4 Fl. Oz.

SKU 920149

Log in to view pricing.
Quick View