MarApr26 Promos
Home skin & bodyskin caremoisturizershydropeptide
Can't find a Product?

skin & body skin care

CATEGORY GENERIC Single Skin & Body
(18 Items)
  • 50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False
    HydroPeptide Nimni Day Cream 1 Fl. Oz.

    HydroPeptide
    Nimni Day Cream

    1 Fl. Oz.

    SKU 921552
    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 84669 921255 921255 1 Hydro-Lock Sleep Mask 2.5 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask 2.5 Fl. Oz. True hydropeptide/newhydropeptidehydrolocksleepmask2.5oz.jpg Special Offer Available 44.00 44.00 44.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydro-Lock Sleep Mask is an overnight, pillow-proof treatment that smooths and perfects skin with a layer of intense, restorative hydration while encouraging cell turnover and providing vital nutrients to leave skin radiant, refreshed, and soft. False Log in to view pricing. False
    HydroPeptide Hydro-Lock Sleep Mask 2.5 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Hydro-Lock Sleep Mask
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 84702 921259 921259 1 Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz. True hydropeptide/newhydropeptidemakeupmelt3.4oz.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Makeup Melt Botanical Cleansing Balm is infused with specialized cleansing extracts and botanicals that melt away all traces of stubborn makeup and impurities without drying or irritating skin. False Log in to view pricing. False
    HydroPeptide Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Makeup Melt Botanical Cleansing Balm
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 84693 921258 921258 1 Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz. True hydropeptide/newhydropeptidemoisturereset1oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Moisture Reset Phytonutrient Facial Oil is an antioxidant-rich blend of 12 precious oils makes up this nutrient-rich, fast-absorbing facial oil. True Log in to view pricing. False
    HydroPeptide Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Moisture Reset Phytonutrient Facial Oil
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 39528 920116 920116 1 Aquaboost 1 Fl. Oz. HydroPeptide HydroPeptide Aquaboost 1 Fl. Oz. False hydropeptide/newhypaquaboost1oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Aquaboost is a lightweight, oil-free moisturizer is thoughtfully formulated for oily and acne-prone skin. False Log in to view pricing. False
    HydroPeptide Aquaboost 1 Fl. Oz.

    HydroPeptide
    Aquaboost

    1 Fl. Oz.

    SKU 920116
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 160582 921485 921485 1 Barrier Builder 1.7 Fl. Oz. HydroPeptide HydroPeptide Barrier Builder 1.7 Fl. Oz. True hydropeptide/HydroPeptideBarrierBuilder1.7oz.jpg Special Offer Available 29.00 29.00 29.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Barrier Builder is a rich therapeutic cream that provides intensive moisture and nourishment to powerfully renew, repair, and reduce inflammation. True Log in to view pricing. False
    HydroPeptide Barrier Builder 1.7 Fl. Oz.

    HydroPeptide
    Barrier Builder
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 168695 921537 921537 1 Collagen ReActivate PM 1 Fl. Oz. HydroPeptide HydroPeptide Collagen ReActivate PM 1 Fl. Oz. False hydropeptide/hydropeptidecollagenreactivatepm1oz.jpg Special Offer Available 68.00 68.00 68.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Collagen ReActivate PM features NIMNI™ Technology which reactivates collagen production while retinol and vitamin C visibly improve the signs of aging. False Log in to view pricing. False
    HydroPeptide Collagen ReActivate PM 1 Fl. Oz.

    HydroPeptide
    Collagen ReActivate PM

    1 Fl. Oz.

    SKU 921537
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 135674 921378 921378 1 Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. HydroPeptide HydroPeptide Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. False hydropeptide/newhypdailydrench1oz.jpg Special Offer Available 39.50 39.50 39.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Daily Drench Hyaluronic Acid Peptide is a one-of-a-kind treatment carefully formulated to deliver a thirst-quenching hit of triple-weight hyaluronic acid for maximum hydration. True Log in to view pricing. False
    HydroPeptide Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz.

    HydroPeptide
    Daily Drench Hyaluronic Acid Peptide Booster

    1 Fl. Oz.

    SKU 921378
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 40023 920107 920107 1 Eye Authority 0.5 Fl. Oz. HydroPeptide HydroPeptide Eye Authority 0.5 Fl. Oz. True hydropeptide/newhypeyeauthority0.5oz.jpg Special Offer Available 41.50 41.50 41.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Eye Authority is a lightweight, universal cream that instantly illuminates the delicate eye area for an immediate bright-eyed boost. True Log in to view pricing. False
    HydroPeptide Eye Authority 0.5 Fl. Oz.

    HydroPeptide
    Eye Authority
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 39549 920105 920105 1 Face Lift 1 Fl. Oz. HydroPeptide HydroPeptide Face Lift 1 Fl. Oz. True hydropeptide/newhypfacelift1oz.jpg Special Offer Available 41.50 41.50 41.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Face Lift is an advanced, ultra-light moisturizer that reinforces skin's defenses while protecting against environmental stressors, reducing the appearance of age spots, restoring youthful firmness, and visibly improving overall skin health. True Log in to view pricing. False
    HydroPeptide Face Lift 1 Fl. Oz.

    HydroPeptide
    Face Lift
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 152728 921454 921454 1 Lumifirm Radiant Tightening Lotion 6.76 Fl. Oz. HydroPeptide HydroPeptide Lumifirm Radiant Tightening Lotion 6.76 Fl. Oz. False hydropeptide/newhyplumifirm6.76oz.jpg Special Offer Available 29.50 29.50 29.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Lumifirm Radiant Tightening Lotion is enriched with firming peptides, brightening niacinamide, and barrier-repairing biotin and ceramides. True Log in to view pricing. False
    HydroPeptide Lumifirm Radiant Tightening Lotion 6.76 Fl. Oz.

    HydroPeptide
    Lumifirm Radiant Tightening Lotion

    6.76 Fl. Oz.

    SKU 921454
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 51029 920254 920254 1 Miracle Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Miracle Mask 0.5 Fl. Oz. True hydropeptide/hydropeptidemiraclemask.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Miracle Mask uses purifying clays to clear impurities while minimizing the appearance of pores, while peptides address the appearance of wrinkles and an advanced complex provides an immediate visible lift. True Log in to view pricing. False
    HydroPeptide Miracle Mask 0.5 Fl. Oz.

    HydroPeptide
    Miracle Mask
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 39592 920106 920106 1 Power Lift 1 Fl. Oz. HydroPeptide HydroPeptide Power Lift 1 Fl. Oz. True hydropeptide/hypupdateretailpowerlift1oz.jpg Special Offer Available 55.00 55.00 55.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Power Lift is an advanced, ultra-rich moisturizer with pineapple ceramides, shea butter, and gravity-defying peptides that work together to plump, lift, and provide the potent hydration dry skin craves without an oily feel. True Log in to view pricing. False
    HydroPeptide Power Lift 1 Fl. Oz.

    HydroPeptide
    Power Lift
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 122371 921351 921351 1 Power Luxe 1 Fl. Oz. HydroPeptide HydroPeptide Power Luxe 1 Fl. Oz. True hydropeptide/hypnewpowerluxe1oz.jpg Special Offer Available 66.00 66.00 66.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Power Luxe is a deeply rich restorative crème that fortifies skin with long-lasting hydration while delivering a luminous, sculpted, and firmed appearance. True Log in to view pricing. False
    HydroPeptide Power Luxe 1 Fl. Oz.

    HydroPeptide
    Power Luxe
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 144014 921412 921412 1 Retinol Eye Renewal 0.5 Fl. Oz. HydroPeptide HydroPeptide Retinol Eye Renewal 0.5 Fl. Oz. True hydropeptide/HYPNewRetinolEyeRenewalHalfOunce.jpg Special Offer Available 65.00 65.00 65.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Retinol Eye Renewal is for anyone looking to achieve firmer, brighter, more youthful under-eyes. True Log in to view pricing. False
    HydroPeptide Retinol Eye Renewal 0.5 Fl. Oz.

    HydroPeptide
    Retinol Eye Renewal
    Bonus Offer
    Log in to view pricing.
    View Sizes
(18 Items)