skin & body skin care

(380 Items)

101551 111431 111431 1 cooling aqua jelly moisturizer 2 Fl. Oz. Dermalogica Dermalogica clear start cooling aqua jelly moisturizer 2 Fl. Oz. False dermalogica/111431dermalogicacoolingaquajellymoisturizertube.jpg Special Offer Available 13.00 13.00 6.50 True True False False 6.50 False False Diversion contract is required Dermalogica clear start cooling aqua jelly is a weightless moisturizer that provides dewy hydration for oily skin. Achieve balanced hydration with all the glow and none of the shine. True Log in to view pricing. False

Dermalogica
clear start cooling aqua jelly moisturizer

2 Fl. Oz.

SKU 111431

Promotional ItemLog in to view pricing.
Quick View
39549 920105 920105 1 Face Lift 1 Fl. Oz. HydroPeptide HydroPeptide Face Lift 1 Fl. Oz. True hydropeptide/newhypfacelift1oz.jpg Special Offer Available 41.50 41.50 41.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Face Lift is an advanced, ultra-light moisturizer that reinforces skin's defenses while protecting against environmental stressors, reducing the appearance of age spots, restoring youthful firmness, and visibly improving overall skin health. True Log in to view pricing. False

HydroPeptide
Face Lift

Promotional ItemLog in to view pricing.
View Sizes
50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

HydroPeptide
Nimni Day Cream

1 Fl. Oz.

SKU 921552

Promotional ItemLog in to view pricing.
Quick View
51065 920258 920258 1 Radiance Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Radiance Mask 0.5 Fl. Oz. False hydropeptide/hpradiancemask.jpg Special Offer Available 24.00 24.00 14.40 True True False False 14.40 False False Diversion contract is required HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. False Log in to view pricing. False

HydroPeptide
Radiance Mask

0.5 Fl. Oz.

SKU 920258

Promotional ItemLog in to view pricing.
Quick View
179174 641456 641456 1 Nourish Hand Cream 1.67 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Lights Co Nourish Hand Cream 1.67 Fl. Oz. False alfaparfmilano/alfaparfnourishhandcream.jpg Special Offer Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Lights Co Nourish Hand Cream is a hand cream with a silky, velvety texture, enriched with the exclusive Pure Bliss fragrance. True Log in to view pricing. False

Alfaparf Milano
Semi Di Lino Lights Co Nourish Hand Cream

1.67 Fl. Oz.

SKU 641456

Log in to view pricing.
Quick View
165579 260534 260534 1 hand wash 13.5 Fl. Oz. amika: amika: hand wash 13.5 Fl. Oz. False amika/amikahandwash13.5floz.jpg Special Offer Available 16.25 16.25 16.25 False False False False 0.00 False False Diversion contract is required amika: hand wash is infused with the signature nourishing sea buckthorn to gentle and effectively cleanse your hands, leaving skin feeling soft and hydrated. True Log in to view pricing. False

amika:
hand wash

13.5 Fl. Oz.

SKU 260534

Log in to view pricing.
Quick View
131777 80792 80792 1 Exfoliating Lip Duo 0.07 Fl. Oz. bodyography bodyography Exfoliating Lip Duo 0.07 Fl. Oz. False bodyography/bodyologyexfoliatinglipduo.jpg Special Offer Available 12.50 12.50 12.50 False False False False 0.00 False False Diversion contract is required bodygraphy Exfoliating Lip Duo is a sugar lip scrub and solid lip oil infused with powerful antioxidant Marula Oil to smooth and condition lips. True Log in to view pricing. False

bodyography
Exfoliating Lip Duo

0.07 Fl. Oz.

SKU 80792

Log in to view pricing.
Quick View
132905 BG SPF Tinted Defense BG SPF Tinted Defense 1 Sun Defense Tinted Moisturizer Click to View Colors bodyography bodyography Sun Defense Tinted Moisturizer Click to View Colors False bodyography/bodyographysundefensetintedmoisturizermaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required bodyography Sun Defense Tinted Moisturizer protects and prefects your skin every day. True Log in to view pricing. False

bodyography
Sun Defense Tinted Moisturizer

Log in to view pricing.
View Details
161150 80928 80928 1 Vanilla Bourbon Body Butter 6.7 Fl. Oz. bodyography bodyography Vanilla Bourbon Body Butter 6.7 Fl. Oz. False bodyography/bodyographyvanillabourbonbodybutter.jpg Special Offer Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required bodyography Vanilla Bourbon Body Butter is a rich body butter that revitalizes and improves skin’s texture with the nourishing power of Glycerin, Ceramides, and 8 + powerful oils. True Log in to view pricing. False

bodyography
Vanilla Bourbon Body Butter

6.7 Fl. Oz.

SKU 80928

Log in to view pricing.
Quick View
161146 80926 80926 1 Vanilla Sea Salt Body Scrub 8.8 Fl. Oz. bodyography bodyography Vanilla Sea Salt Body Scrub 8.8 Fl. Oz. False bodyography/bodyographyvanillabodyscrub.jpg Special Offer Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required bodyography Vanilla Sea Salt Body Scrub is a nourishing Body Scrub gently buffs away dead skin cells, visibly improving the texture, tone, and radiance of the skin. True Log in to view pricing. False

bodyography
Vanilla Sea Salt Body Scrub

8.8 Fl. Oz.

SKU 80926

Log in to view pricing.
Quick View
22782 350101 350101 1 Double Gommage Scrub 5.07 Fl. Oz. Cirépil Cirépil Double Gommage Scrub 5.07 Fl. Oz. False cirpil/photos_image_1183.jpg Special Offer Available 13.25 13.25 13.25 False False False False 0.00 False False Diversion contract is required Keeps ingrown hairs away and encourages healthy and soft skin. True Log in to view pricing. False

Cirépil
Double Gommage Scrub

5.07 Fl. Oz.

SKU 350101

Log in to view pricing.
Quick View
16554 351380 351380 1 Post Refreshing Gel 6.76 Fl. Oz. Cirépil Cirépil Post Refreshing Gel 6.76 Fl. Oz. True cirpil/cirepilpostrefreshinggel6.76oz.jpg Special Offer Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required Apply Cirépil Post Refreshing Gel after waxing to soothe and cool the skin. True Log in to view pricing. False

Cirépil
Post Refreshing Gel

Log in to view pricing.
View Sizes
16506 351100 351100 1 Pre & Post Depilatory Oil 8.45 Fl. Oz. Cirépil Cirépil Pre & Post Depilatory Oil 8.45 Fl. Oz. True cirpil/cirepilprepostdepilatoryoil8.45oz.jpg Special Offer Available 15.20 15.20 15.20 False False False False 0.00 False False Diversion contract is required Use Cirépil Pre & Post Depilatory Oil prior to waxing to protect skin and create a barrier between skin and wax, and use post wax to remove any residue. (Liter Pump not included) True Log in to view pricing. False

Cirépil
Pre & Post Depilatory Oil

Log in to view pricing.
View Sizes
16540 351140 351140 1 Purifying Blue Lotion Cleanser 8.45 Fl. Oz. Cirépil Cirépil Purifying Blue Lotion Cleanser 8.45 Fl. Oz. True cirpil/cirepilpurifyingbluelotioncleanser8.45oz.jpg Special Offer Available 15.20 15.20 15.20 False False False False 0.00 False False Diversion contract is required Use Cirépil Purifying Blue Lotion Cleanser to sanitize the skin prior to waxing. False Log in to view pricing. False

Cirépil
Purifying Blue Lotion Cleanser

Log in to view pricing.
View Sizes
106507 411943 411943 1 Cleansing Gel 6.76 Fl. Oz. Comfort Zone Comfort Zone Active Pureness Cleansing Gel 6.76 Fl. Oz. True comfortzone/comfortzoneactivepurenesscleansinggel6.76oz.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required Comfort Zone Active Pureness Cleansing Gel features 3% Gluconolactone. The exfoliating action allows to cleanse the skin and clear the pores from makeup and excess sebum. True Log in to view pricing. False

Comfort Zone
Active Pureness Cleansing Gel

Log in to view pricing.
View Sizes