hair care

(863 Items)
  • 23116 91045 91045 1 Davines Your Hair Assistant Prep Rich Balm 6.94 Fl. Oz. True davines/davinesyhapreprichbalm694flozredo.jpg 20.00 20.00 20.00 False False False 0.00 False False Diversion contract is required 0 Davines Your Hair Assistant Prep Rich Balm nourishes dehydrated and stressed hair and prepares it to be styled safely. True Log in to view pricing. False

    Davines Your Hair Assistant Prep Rich Balm

    view sizes
    View Sizes
  • 23107 91043 91043 1 Davines Your Hair Assistant Prep Shampoo 8.45 Fl. Oz. True davines/davinesyhaprepshampoo845floz.jpg 18.00 18.00 18.00 False False False 0.00 False False Diversion contract is required 0 Hydrating and nourishing, with a rich and voluminous foam, Davines Your Hair Assistant Prep Shampoo gently cleans hair, removes styling residue and leaves it feeling soft and light, ready for styling. False Log in to view pricing. False

    Davines Your Hair Assistant Prep Shampoo

    view sizes
    View Sizes
  • 5545 72948 72948 1 MOROCCANOIL TREATMENT LIGHT 3.4 Fl. Oz. True moroccanoil/motreatlight.jpg 22.00 22.00 22.00 False False False 0.00 False False Diversion contract is required 0 Enjoy healthy, silky, shiny hair that's full of life. MOROCCANOIL® TREATMENT LIGHT is specifically formulated for the delicate needs of light-colored (including platinum and white) and fine hair. False Log in to view pricing. False

    MOROCCANOIL TREATMENT LIGHT

    view sizes
    View Sizes
  • 5541 72900 72900 1 MOROCCANOIL TREATMENT ORIGINAL 3.4 Fl. Oz. True moroccanoil/mooriginal3oz.jpg 22.00 22.00 22.00 False False False 0.00 False False Diversion contract is required 0 Outshine the rest and get the silky, shiny and healthy hair you've always wanted with MOROCCANOIL® TREATMENT. False Log in to view pricing. False

    MOROCCANOIL TREATMENT ORIGINAL

    view sizes
    View Sizes
  • 65425 296447 296447 1 Alfaparf Milano Semi Di Lino Diamond Illuminating Conditioner 6.76 Fl. Oz. True alfaparfmilano/am_sdl-diamond-illuminating-conditioner-200ml.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Diamond Illuminating Conditioner is an illuminating conditioner for normal hair. It detangles and gives extreme shine, making the hair soft and lightweight. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Diamond Illuminating Conditioner

    Promotional Item:
    view sizes
    View Sizes
  • 65423 296445 296445 1 Alfaparf Milano Semi Di Lino Diamond Illuminating Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/am_sdl-diamond-illuminating-low-shampoo-250ml.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Diamond Illuminating Low Shampoo is an illuminating, delicate shampoo for normal hair. It gently cleanses and gives extreme shine, making your hair soft and silky. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Diamond Illuminating Low Shampoo

    Promotional Item:
    view sizes
    View Sizes
  • 65417 296419 296419 1 Alfaparf Milano Semi Di Lino Moisture Nutritive Leave-in Conditioner 6.76 Fl. Oz. True alfaparfmilano/am_sdl-moisture-nutritive-leave-in-conditioner-200ml.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Moisture Nutritive Leave-in Conditioner is a nourishing leave-in conditioner for dry hair: softens the hair fiber and makes it easier to control without weighing it down, for silky and radiant hair. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Moisture Nutritive Leave-in Conditioner

    Promotional Item:
    view sizes
    View Sizes
  • 65410 630166 630166 1 Alfaparf Milano Semi Di Lino Moisture Nutritive Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/am_sdl-moisture-nutritive-low-shampoo-250ml.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Moisture Nutritive Low Shampoo is a gentle nourishing shampoo for dry hair. It gently cleanses, moisturizes and nourishes the hair fiber, making your hair soft and shiny. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Moisture Nutritive Low Shampoo

    Promotional Item:
    view sizes
    View Sizes
  • 65391 296408 296408 1 Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/am_sdl-reconstruction-reparative-low-shampoo-8-45_oz.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo is a gentle restructuring shampoo for damaged hair. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo

    Promotional Item:
    view sizes
    View Sizes
  • 89157 632648 632648 1 Alfaparf Milano Semi Di Lino Scalp Care Scalp Relief Calming Micellar Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/alfaparfsdlscalpreliefcalmshampoo8.45oz.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Semi Di Lino Scalp Relief Calming Micellar Low Shampoo is for sensitive scalps: gently cleanses counteracting feelings of discomfort. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Scalp Care Scalp Relief Calming Micellar Low Shampoo

    Promotional Item:
    view sizes
    View Sizes
  • 89166 632641 632641 1 Alfaparf Milano Semi Di Lino Scalp Care Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/alfaparfsdlscalprenewenergyshampoo8.45oz.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Semi Di Lino Scalp Renew Energizing Low Shampoo gently strengthens, re-densifies and stimulates the hair follicles so that both the scalp and hair fibers can regain balance, strength and body. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Scalp Care Scalp Renew Energizing Low Shampoo

    Promotional Item:
    view sizes
    View Sizes
  • 90780 632657 632657 1 Alfaparf Milano Semi Di Lino Volume Volumizing Low Shampoo 8.45 Fl. Oz. True alfaparfmilano/apsdlvolumeshampoo845oz.jpg 11.00 11.00 11.00 False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Semi Di Lino Volumizing Low Shampoo is a gentle volumizing and body-intensifying shampoo for fine hair that gently cleanses and enhances the thickness of the hair fibers for natural volume. False Log in to view pricing. False

    Alfaparf Milano Semi Di Lino Volume Volumizing Low Shampoo

    Promotional Item:
    view sizes
    View Sizes
  • 55463 630175 630175 1 Alfaparf Milano Style Stories Blow Dry Cream 5.1 Fl. Oz. False alfaparfmilano/mj18alfaparfblowdrycream507floz.jpg 12.00 12.00 8.40 True True False 8.40 False False Diversion contract is required 0 Alfaparf Milano Style Stories Blow Dry Cream for increased body, makes drying quicker and easier. Fights frizz and does not weigh the hair down, leaving it soft and lightweight. Also ideal for pre-cut use. False Log in to view pricing. False

    Alfaparf Milano Style Stories Blow Dry Cream

    5.1 Fl. Oz.

    SKU 630175

    Promotional Item:Log in to view pricing.
    Quick View
  • 55481 297570 297570 1 Alfaparf Milano Style Stories Defining Wax 2.64 Fl. Oz. False alfaparfmilano/alfaprfstylestoriesdefiningwaxpf017570vas75ml264floz.jpg 12.00 12.00 8.40 True True False 8.40 False False Diversion contract is required 0 Alfaparf Milano Style Stories Defining Wax is a soft wax, for defined results. Ideal for maximizing the details of any look. Glossy finish. False Log in to view pricing. False

    Alfaparf Milano Style Stories Defining Wax

    2.64 Fl. Oz.

    SKU 297570

    Promotional Item:Log in to view pricing.
    Quick View
  • 55490 298291 298291 1 Alfaparf Milano Style Stories Extreme Hairspray 10.5 Fl. Oz. False alfaparfmilano/alfaparfstylestoriesextremehairspray300ml105floz.jpg 12.00 12.00 8.40 True True False 8.40 False False Diversion contract is required 0 Alfaparf Milano Style Stories Extreme Hairspray is a hairspray for structured results, it fixes the hair style without weighing it down. False Log in to view pricing. False

    Alfaparf Milano Style Stories Extreme Hairspray

    10.5 Fl. Oz.

    SKU 298291

    Promotional Item:Log in to view pricing.
    Quick View
(863 Items)

  • SKU:
Note: Can only be ordered in multiples of {0}
Please call your Salon Services representative or Customer Care (800) 251-4247 for more details.

View Full Details on Product Page

Add to Shopping List

To create a list enter a list name and click the "create list" button.

Create Shopping List

'