skin & body skin care

(53 Items)

39549 920105 920105 1 Face Lift 1 Fl. Oz. HydroPeptide HydroPeptide Face Lift 1 Fl. Oz. True hydropeptide/newhypfacelift1oz.jpg Special Offer Available 41.50 41.50 41.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Face Lift is an advanced, ultra-light moisturizer that reinforces skin's defenses while protecting against environmental stressors, reducing the appearance of age spots, restoring youthful firmness, and visibly improving overall skin health. True Log in to view pricing. False

HydroPeptide
Face Lift

Promotional ItemLog in to view pricing.
View Sizes
50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

HydroPeptide
Nimni Day Cream

1 Fl. Oz.

SKU 921552

Promotional ItemLog in to view pricing.
Quick View
51065 920258 920258 1 Radiance Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Radiance Mask 0.5 Fl. Oz. False hydropeptide/hpradiancemask.jpg Special Offer Available 24.00 24.00 14.40 True True False False 14.40 False False Diversion contract is required HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. False Log in to view pricing. False

HydroPeptide
Radiance Mask

0.5 Fl. Oz.

SKU 920258

Promotional ItemLog in to view pricing.
Quick View
39411 920119 920119 1 5X Power Peel 30 pk. HydroPeptide HydroPeptide 5X Power Peel 30 pk. False hydropeptide/HydroP5xPowerPeelUpdate25.jpg Special Offer Available 36.50 36.50 36.50 False False False False 0.00 False False Diversion contract is required Hydropeptide 5X Power Peel resurfaces, clarifies, brightens, and smooths away the appearance of wrinkles with five powerful daily exfoliants. True Log in to view pricing. False

HydroPeptide
5X Power Peel

30 pk.

SKU 920119

Log in to view pricing.
Quick View
70656 921563 921563 1 Hydraflora Probiotic Essence 2.7 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydraflora Probiotic Essence 2.7 Fl. Oz. False hydropeptide/hydropeptidehydraflora2.7oz.jpg Special Offer Available 23.00 23.00 23.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydraflora Probiotic Essence Toner is formulated with a powerful pre- and probiotic complex to help maintain healthy microflora and provide skin barrier support. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Hydraflora Probiotic Essence

2.7 Fl. Oz.

SKU 921563

Log in to view pricing.
Quick View
73646 920356 920356 1 Hydroactive Cleanse Micellar Facial Cloths 30 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 30 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required Remove build-up and deeply purify with HydroPeptide Micellar Cleansing Cloths. False Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

30 pk.

SKU 920356

Log in to view pricing.
Quick View
70659 920152 920152 1 Hydroactive Cleanse Micellar Facial Cloths 5 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 5 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 50.00 50.00 50.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydroactive Cleanse Micellar Facial Cloths gently remove makeup, debris and pollution while purifying the skin in one sweep. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

5 pk.

SKU 920152

Log in to view pricing.
Quick View
127117 921361 921361 1 Triple Acid Peptide Peel 1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Triple Acid Peptide Peel 1 Fl. Oz. True hydropeptide/hydropeptidetripleacidpeel1oz30ml.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Triple Acid Peptide Peel is a leave-on face peel designed to encourage cell turnover and improve signs of aging. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Detox Triple Acid Peptide Peel

Log in to view pricing.
View Sizes
84664 921254 921254 1 Cashmere Cleanse 6.76 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Cashmere Cleanse 6.76 Fl. Oz. True hydropeptide/hypnewcashmerecleanse6oz.jpg Special Offer Available 27.00 27.00 27.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Cashmere Cleanser is a comforting cleanser that gently whisks away impurities without stripping or drying the skin. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore Cashmere Cleanse

Log in to view pricing.
View Sizes
84669 921255 921255 1 Hydro-Lock Sleep Mask 2.5 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask 2.5 Fl. Oz. True hydropeptide/newhydropeptidehydrolocksleepmask2.5oz.jpg Special Offer Available 44.00 44.00 44.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydro-Lock Sleep Mask is an overnight, pillow-proof treatment that smooths and perfects skin with a layer of intense, restorative hydration while encouraging cell turnover and providing vital nutrients to leave skin radiant, refreshed, and soft. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore Hydro-Lock Sleep Mask

Log in to view pricing.
View Sizes
84685 921257 921257 1 LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. True hydropeptide/hydropeptideliplockhydrator0.24oz.jpg Special Offer Available 21.00 21.00 21.00 False False False False 0.00 False False Diversion contract is required HydroPeptide LipLock Hydrator Peptide Infused Lip Mask provides softer, plumper-looking lips day or night with natural oils that dramatically boost hydration while peptides visibly improve volume and reduce the appearance of lip lines True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask

Log in to view pricing.
View Sizes
84702 921259 921259 1 Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Makeup Melt Botanical Cleansing Balm 3.4 Fl. Oz. True hydropeptide/newhydropeptidemakeupmelt3.4oz.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Makeup Melt Botanical Cleansing Balm is infused with specialized cleansing extracts and botanicals that melt away all traces of stubborn makeup and impurities without drying or irritating skin. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore Makeup Melt Botanical Cleansing Balm

Log in to view pricing.
View Sizes
84693 921258 921258 1 Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Moisture Reset Phytonutrient Facial Oil 1 Fl. Oz. True hydropeptide/newhydropeptidemoisturereset1oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Moisture Reset Phytonutrient Facial Oil is an antioxidant-rich blend of 12 precious oils makes up this nutrient-rich, fast-absorbing facial oil. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore Moisture Reset Phytonutrient Facial Oil

Log in to view pricing.
View Sizes
39528 920116 920116 1 Aquaboost 1 Fl. Oz. HydroPeptide HydroPeptide Aquaboost 1 Fl. Oz. False hydropeptide/newhypaquaboost1oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Aquaboost is a lightweight, oil-free moisturizer is thoughtfully formulated for oily and acne-prone skin. True Log in to view pricing. False

HydroPeptide
Aquaboost

1 Fl. Oz.

SKU 920116

Log in to view pricing.
Quick View
51028 920256 920256 1 Balancing Mask 1 Fl. Oz. HydroPeptide HydroPeptide Balancing Mask 1 Fl. Oz. False hydropeptide/newhypbalancingmask1oz.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Balancing Mask is a creamy clay-based age-defying mask that strengthens skin against environmental stressors and infuses it with the protective nutrients it needs to stay balanced, calm, hydrated, and youthful-looking. False Log in to view pricing. False

HydroPeptide
Balancing Mask

1 Fl. Oz.

SKU 920256

Log in to view pricing.
Quick View