MarApr26 Promos

skin & body skin care

(4 Items)
  • 50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False
    HydroPeptide Nimni Day Cream 1 Fl. Oz.

    HydroPeptide
    Nimni Day Cream

    1 Fl. Oz.

    SKU 921552

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 135674 921378 921378 1 Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. HydroPeptide HydroPeptide Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. False hydropeptide/newhypdailydrench1oz.jpg Special Offer Available 39.50 39.50 39.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Daily Drench Hyaluronic Acid Peptide is a one-of-a-kind treatment carefully formulated to deliver a thirst-quenching hit of triple-weight hyaluronic acid for maximum hydration. True Log in to view pricing. False
    HydroPeptide Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz.

    HydroPeptide
    Daily Drench Hyaluronic Acid Peptide Booster

    1 Fl. Oz.

    SKU 921378

    Bonus Offer
    Quick View
  • 51029 920254 920254 1 Miracle Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Miracle Mask 0.5 Fl. Oz. True hydropeptide/hydropeptidemiraclemask.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Miracle Mask uses purifying clays to clear impurities while minimizing the appearance of pores, while peptides address the appearance of wrinkles and an advanced complex provides an immediate visible lift. True Log in to view pricing. False
    HydroPeptide Miracle Mask 0.5 Fl. Oz.

    HydroPeptide
    Miracle Mask

    Bonus Offer
    View Sizes
  • 144014 921412 921412 1 Retinol Eye Renewal 0.5 Fl. Oz. HydroPeptide HydroPeptide Retinol Eye Renewal 0.5 Fl. Oz. True hydropeptide/HYPNewRetinolEyeRenewalHalfOunce.jpg Special Offer Available 65.00 65.00 65.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Retinol Eye Renewal is for anyone looking to achieve firmer, brighter, more youthful under-eyes. True Log in to view pricing. False
    HydroPeptide Retinol Eye Renewal 0.5 Fl. Oz.

    HydroPeptide
    Retinol Eye Renewal

    Bonus Offer
    View Sizes
(4 Items)