skin & body skin care

(19 Items)

153751 711462 711462 1 deep acne liquid patch TESTER 0.5 Fl. Oz. Dermalogica Dermalogica active clearing deep acne liquid patch TESTER 0.5 Fl. Oz. False dermalogica/dermalogicadeepacneliquidpatchtester0.5floz.jpg Special Offer Available 16.00 22.40 22.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica active clearing deep acne liquid patch is a sulfur-based, liquid-to-patch spot treatment for painful, cystic acne. True Log in to view pricing. False

Dermalogica
active clearing deep acne liquid patch TESTER

0.5 Fl. Oz.

SKU 711462

Log in to view pricing.
Quick View
119360 811063 811063 1 super rich repair 3.4 Fl. Oz. Dermalogica Dermalogica age smart super rich repair 3.4 Fl. Oz. True dermalogica/811063dermalogicasuperrichrepairtube.jpg Special Offer Available 72.50 101.50 101.50 False False False False 0.00 False False Diversion contract is required 0 Dermalogica super rich repair is a deeply nourishing skin treatment cream. True Log in to view pricing. False

Dermalogica
age smart super rich repair

Log in to view pricing.
View Sizes
127310 111449 111449 1 awaken peptide eye gel 0.5 Fl. Oz. Dermalogica Dermalogica awaken peptide eye gel 0.5 Fl. Oz. False dermalogica/dermalogicaawakenpeptideeyegel05oz.jpg Special Offer Available 29.50 41.30 41.30 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

0.5 Fl. Oz.

SKU 111449

Log in to view pricing.
Quick View
135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE False dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.50 0.70 0.70 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

SAMPLE

SKU 611449

Log in to view pricing.
Quick View
135603 711499 711499 1 awaken peptide eye gel TESTER 0.5 Fl. Oz. Dermalogica Dermalogica awaken peptide eye gel TESTER 0.5 Fl. Oz. False dermalogica/dermalogicaawakenpeptideeyegel05oztester.png Special Offer Available 28.50 39.90 39.90 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel TESTER

0.5 Fl. Oz.

SKU 711499

Log in to view pricing.
Quick View
128123 111447 111447 1 post-breakout fix 0.5 Fl. Oz. Dermalogica Dermalogica clear start post-breakout fix 0.5 Fl. Oz. False dermalogica/dermalogicaclearstartpostbreakoutfix05ozredo.jpg Special Offer Available 12.25 12.25 12.25 False False False False 0.00 False False Diversion contract is required 0 Dermalogica clear start post-breakout fix is a gel spot treatment that helps fade and brighten the post-inflammatory hyperpigmentation (aka red and dark spots) that popping pimples leaves behind. True Log in to view pricing. False

Dermalogica
clear start post-breakout fix

0.5 Fl. Oz.

SKU 111447

Log in to view pricing.
Quick View
42432 111257 111257 1 stress positive eye lift 0.85 Fl. Oz. Dermalogica Dermalogica daily skin health stress positive eye lift 0.85 Fl. Oz. False dermalogica/111257dermalogicastresspositiveeyelifttube.jpg Special Offer Available 37.00 53.20 53.20 False False False False 0.00 False False Diversion contract is required 0 Dermalogica stress positive eye lift is a de-puffing eye treatment and masque. True Log in to view pricing. False

Dermalogica
daily skin health stress positive eye lift

0.85 Fl. Oz.

SKU 111257

Log in to view pricing.
Quick View
147132 111462 111462 1 deep acne invisible liquid patch 0.5 Fl. Oz. Dermalogica Dermalogica deep acne invisible liquid patch 0.5 Fl. Oz. False dermalogica/dermalogicadeepacneinvisibleliquidpatch.jpg Special Offer Available 17.00 23.80 23.80 False False False False 0.00 False False Diversion contract is required 0 Dermalogica deep acne invisible liquid patch is an invisible sulfur-based spot treatment transforms from liquid to patch to soothe, clear, and help prevent future breakouts. True Log in to view pricing. False

Dermalogica
deep acne invisible liquid patch

0.5 Fl. Oz.

SKU 111462

Log in to view pricing.
Quick View
55296 211282 211282 1 PRO multi-active scaling gel 8 Fl. Oz. Dermalogica Dermalogica PRO multi-active scaling gel 8 Fl. Oz. False dermalogica/211282dermalogicapromultiactivescalinggel8oztube.jpg Special Offer Available 46.00 64.40 64.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica Professional multi-active scaling gel is a versatile, multi-purpose gel that can be used alone to facilitate extractions, or mixed with a cleanser or exfoliant for an intensified effect. True Log in to view pricing. False

Dermalogica
PRO multi-active scaling gel

8 Fl. Oz.

SKU 211282

Log in to view pricing.
Quick View
65542 211310 211310 1 advanced renewal peel - glycolic acid PRO 4 Fl. Oz. Dermalogica Dermalogica pro only advanced renewal peel - glycolic acid PRO 4 Fl. Oz. False dermalogica/211310dermalogicaproadvancedrenewalpeel4oztube.jpg Special Offer Available 89.00 124.60 124.60 False False False False 0.00 False False Diversion contract is required 0 A powerful peel that resurfaces skin to help fight the visible effects of AGEs to minimize the appearance of fine lines and wrinkles. Glycolic Acid, complexed with Phytic Acid and Opuntia Flower Extract reduce the appearance of hyper pigmentation, fine lines and wrinkles, and evens skin tone. True Log in to view pricing. False

Dermalogica
pro only advanced renewal peel - glycolic acid

PRO 4 Fl. Oz.

SKU 211310

Log in to view pricing.
Quick View
65548 211309 211309 1 AGEreversal peel PRO 4 Fl. Oz. Dermalogica Dermalogica pro only AGEreversal peel PRO 4 Fl. Oz. False dermalogica/211309dermalogicaproAGEreversalpeel4oztube.jpg Special Offer Available 96.00 134.40 134.40 False False False False 0.00 False False Diversion contract is required 0 A professional strength AGE-reversing peel to minimize advanced signs of aging. TCA complexed with Rice-derived Phytic Acid, Garden Sprout Extract, Soy Genistein, and Myristoyl Nonapeptide-3 minimize the appearance of deep lines and wrinkles, hyper pigmentation, and brighten dull skin. True Log in to view pricing. False

Dermalogica
pro only AGEreversal peel

PRO 4 Fl. Oz.

SKU 211309

Log in to view pricing.
Quick View
65549 211311 211311 1 neutralizing solution PRO 4 Fl. Oz. Dermalogica Dermalogica pro only neutralizing solution PRO 4 Fl. Oz. False dermalogica/211311dermalogicaneutralizingsolution4oz.jpg Special Offer Available 42.00 58.80 58.80 False False False False 0.00 False False Diversion contract is required 0 A ready-to-use non-aqueous neutralizer that helps soothe the skin and helps restore its natural pH.It also calms and soothes irritated skin. True Log in to view pricing. False

Dermalogica
pro only neutralizing solution

PRO 4 Fl. Oz.

SKU 211311

Log in to view pricing.
Quick View
65546 211333 211333 1 powerclear peel - salicylic acid PRO 4 Fl. Oz. Dermalogica Dermalogica pro only powerclear peel - salicylic acid PRO 4 Fl. Oz. False dermalogica/211333dermalogicapowerclearpeelsalicylicacid4ozbottle.jpg Special Offer Available 89.00 124.60 124.60 False False False False 0.00 False False Diversion contract is required 0 A potent clearing peel for breakout-prone skin to target blemishes and visibly and diminish post-inflammatory hyper pigmentation. True Log in to view pricing. False

Dermalogica
pro only powerclear peel - salicylic acid

PRO 4 Fl. Oz.

SKU 211333

Log in to view pricing.
Quick View
37751 211243 211243 1 PRO post extraction solution 8 Fl. Oz. Dermalogica Dermalogica PRO post extraction solution 8 Fl. Oz. False dermalogica/211243dermalogicapostextractionsolution8ozbottle.jpg Special Offer Available 26.00 36.40 36.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica post extraction solution is an acne treatment that contains key ingredients like Triclosan to kill germs. True Log in to view pricing. False

Dermalogica
PRO post extraction solution

8 Fl. Oz.

SKU 211243

Log in to view pricing.
Quick View
77424 300782 300782 1 Advanced Student Kit 2 pc. Dermalogica Dermalogica pro power peel Advanced Student Kit 2 pc. False dermalogicaprofessional/dmpadvstudentpropowerpeelkit.jpg Special Offer Available 100.00 120.00 120.00 False False False False 0.00 False False Diversion contract is required 0 Dermalogica Professional Pro Power Peel Advanced Student Kit includes peels. True Log in to view pricing. False

Dermalogica
pro power peel Advanced Student Kit

2 pc.

SKU 300782

Log in to view pricing.
Quick View