skin & body

(18 Items)

42471 920132 920132 1 Nimni Cream 0.5 Fl. Oz. HydroPeptide HydroPeptide Nimni Cream 0.5 Fl. Oz. True hydropeptide/newhydropeptidenimnicream05oz.jpg Special Offer Available 56.00 56.00 40.00 True True False False 40.00 False False Diversion contract is required 0 HydroPeptide Nimni Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

HydroPeptide
Nimni Cream

Promotional ItemLog in to view pricing.
View Sizes
50655 920257 920257 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 56.00 56.00 40.00 True True False False 40.00 False False Diversion contract is required 0 HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

HydroPeptide
Nimni Day Cream

1 Fl. Oz.

SKU 920257

Promotional ItemLog in to view pricing.
Quick View
39411 920119 920119 1 5X Power Peel 30 pk. HydroPeptide HydroPeptide 5X Power Peel 30 pk. False hydropeptide/HydroP5xPowerPeelUpdate25.jpg Special Offer Available 36.50 36.50 36.50 False False False False 0.00 False False Diversion contract is required 0 Hydropeptide 5X Power Peel resurfaces, clarifies, brightens, and smooths away the appearance of wrinkles with five powerful daily exfoliants. True Log in to view pricing. False

HydroPeptide
5X Power Peel

30 pk.

SKU 920119

Log in to view pricing.
Quick View
51028 920256 920256 1 Balancing Mask 1 Fl. Oz. HydroPeptide HydroPeptide Balancing Mask 1 Fl. Oz. False hydropeptide/newhypbalancingmask1oz.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Balancing Mask is a creamy clay-based age-defying mask that strengthens skin against environmental stressors and infuses it with the protective nutrients it needs to stay balanced, calm, hydrated, and youthful-looking. True Log in to view pricing. False

HydroPeptide
Balancing Mask

1 Fl. Oz.

SKU 920256

Log in to view pricing.
Quick View
135674 921378 921378 1 Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. HydroPeptide HydroPeptide Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. False hydropeptide/newhypdailydrench1oz.jpg Special Offer Available 39.50 39.50 39.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Daily Drench Hyaluronic Acid Peptide is a one-of-a-kind treatment carefully formulated to deliver a thirst-quenching hit of triple-weight hyaluronic acid for maximum hydration. True Log in to view pricing. False

HydroPeptide
Daily Drench Hyaluronic Acid Peptide Booster

1 Fl. Oz.

SKU 921378

Log in to view pricing.
Quick View
68068 921235 921235 1 Firm-a-Fix Neck Nectar 1.7 Fl. Oz. HydroPeptide HydroPeptide Firm-a-Fix Neck Nectar 1.7 Fl. Oz. False hydropeptide/newhypfirmafixnectar1.7oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Firma-Fix Neck Nectar is designed specifically for use on your neck and décolleté. True Log in to view pricing. False

HydroPeptide
Firm-a-Fix Neck Nectar

1.7 Fl. Oz.

SKU 921235

Log in to view pricing.
Quick View
39571 920121 920121 1 Lumapro-C 1 Fl. Oz. HydroPeptide HydroPeptide Lumapro-C 1 Fl. Oz. True hydropeptide/newhyplumapro-c1oz.jpg Special Offer Available 74.50 74.50 74.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Lumapro-C is a spot-fading serum powered by a highly stable form of antioxidant-rich vitamin C that diminishes the appearance of existing hyperpigmentation while enhancing overall brightness to achieve ultimate radiance, clarity, and skin refinement. True Log in to view pricing. False

HydroPeptide
Lumapro-C

Log in to view pricing.
View Sizes
51029 920254 920254 1 Miracle Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Miracle Mask 0.5 Fl. Oz. True hydropeptide/hydropeptidemiraclemask.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Miracle Mask uses purifying clays to clear impurities while minimizing the appearance of pores, while peptides address the appearance of wrinkles and an advanced complex provides an immediate visible lift. True Log in to view pricing. False

HydroPeptide
Miracle Mask

Log in to view pricing.
View Sizes
52421 921140 921140 1 Nimni Day Cream TESTER 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream TESTER 1 Fl. Oz. False hydropeptide/hpnimnidaycream.jpg Special Offer Available 45.00 45.00 45.00 False False False False 0.00 False False Diversion contract is required 0 Discover the anti-aging benefits of Nimni technology through Dr. Marcel Nimni's revolutionary patented collagen support complex. This exclusive amino acid blend offers significant improvement in the appearance of skin's fullness and elasticity. True Log in to view pricing. False

HydroPeptide
Nimni Day Cream TESTER

1 Fl. Oz.

SKU 921140

Log in to view pricing.
Quick View
39589 920118 920118 1 Polish & Plump Peel 2 pc. HydroPeptide HydroPeptide Polish & Plump Peel 2 pc. False hydropeptide/hypnewpolishplump2pc.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Polish & Plump Peel provides the benefits of a gentle microdermabrasion, a light chemical peel and a pampering facial in just two easy steps. True Log in to view pricing. False

HydroPeptide
Polish & Plump Peel

2 pc.

SKU 920118

Log in to view pricing.
Quick View
39519 920218 920218 1 Lumapro-C 2 Fl. Oz. HydroPeptide HydroPeptide Professional Lumapro-C 2 Fl. Oz. False hydropeptide/HYPNewProPackagingLumaPro-C2oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Lumapro-C is a spot-fading serum powered by a highly stable form of antioxidant-rich vitamin C that diminishes the appearance of existing hyperpigmentation while enhancing overall brightness to achieve ultimate radiance, clarity, and skin refinement. True Log in to view pricing. False

HydroPeptide
Professional Lumapro-C

2 Fl. Oz.

SKU 920218

Log in to view pricing.
Quick View
39529 920230 920230 1 Peel 2 Plumping Activator 4 Fl. Oz. HydroPeptide HydroPeptide Professional Peel 2 Plumping Activator 4 Fl. Oz. False hydropeptide/HYPNewProPackagingPeel24oz.jpg Special Offer Available 34.00 34.00 34.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Peel 2 is for intense exfoliation and features higher levels of alpha-hydroxy acids, and works in conjunction with Vitamin C Peel 1 or Apple Peel 1 crystals. True Log in to view pricing. False

HydroPeptide
Professional Peel 2 Plumping Activator

4 Fl. Oz.

SKU 920230

Log in to view pricing.
Quick View
151484 921234 921234 1 Radiance Mask 6 Fl. Oz. HydroPeptide HydroPeptide Professional Radiance Mask 6 Fl. Oz. False hydropeptideprofessional/hydropeptideradiancemask6oz.png Special Offer Available 48.00 48.00 48.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. True Log in to view pricing. False

HydroPeptide
Professional Radiance Mask

6 Fl. Oz.

SKU 921234

Log in to view pricing.
Quick View
39543 920231 920231 1 Vitamin C Peel 1 4 Fl. Oz. HydroPeptide HydroPeptide Professional Vitamin C Peel 1 4 Fl. Oz. False hydropeptide/HYPNewVitaminCPeel14oz.jpg Special Offer Available 34.00 34.00 34.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Vitamin C Peel 1 takes exfoliation to the next level with powerful microdermabrasion crystals that leaves rough, lackluster skin looking luminous. True Log in to view pricing. False

HydroPeptide
Professional Vitamin C Peel 1

4 Fl. Oz.

SKU 920231

Log in to view pricing.
Quick View
51065 920258 920258 1 Radiance Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Radiance Mask 0.5 Fl. Oz. False hydropeptide/hpradiancemask.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. True Log in to view pricing. False

HydroPeptide
Radiance Mask

0.5 Fl. Oz.

SKU 920258

Log in to view pricing.
Quick View