MayJune2024 Promotions

dermalogica

(11 Items)
  • 19327 611596 611596 4 active moist SAMPLE Dermalogica Dermalogica active moist SAMPLE dermalogica/611596dermalogicaactivemoisttube.jpg Bonus Deal Available 0.20 0.28 0.28 False False False False 0.00 False False Diversion contract is required 0 Dermologica active moist is a light, oil-free lotion that helps improve skin texture and combat surface dehydration. True Log in to view pricing. False
    Dermalogica active moist SAMPLE

    Dermalogica
    active moist

    SAMPLE

    SKU 611596

    Bonus Offer
    Quick View
  • 135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Bonus Deal Available 0.50 0.70 0.70 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False
    Dermalogica awaken peptide eye gel SAMPLE

    Dermalogica
    awaken peptide eye gel

    SAMPLE

    SKU 611449

    Bonus Offer
    Quick View
  • 130309 611455 611455 1 Circular Hydration Serum Sample 0.03 Fl. Oz. Dermalogica Dermalogica Circular Hydration Serum Sample 0.03 Fl. Oz. dermalogica/dermalogicacircularhydrationserumsample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica circular hydration serum immediately floods skin with hydration, replenishes from within, and helps prevent future hydration evaporation. False Log in to view pricing. False
    Dermalogica Circular Hydration Serum Sample 0.03 Fl. Oz.

    Dermalogica
    Circular Hydration Serum Sample

    0.03 Fl. Oz.

    SKU 611455

    Bonus Offer
    Quick View
  • 120828 611439 611439 1 daily glycolic cleanser SAMPLE Dermalogica Dermalogica daily glycolic cleanser SAMPLE dermalogica/demalogicadailyglycoliccleansersample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica daily glycolic cleanser is a brightening and conditioning cleanser that renews dull, uneven skin tone and helps remove buildup caused by environmental factors. True Log in to view pricing. False
    Dermalogica daily glycolic cleanser SAMPLE

    Dermalogica
    daily glycolic cleanser

    SAMPLE

    SKU 611439

    Bonus Offer
    Quick View
  • 19307 111248 111248 1 daily microfoliant - travel bright 0.45 Fl. Oz. Dermalogica Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz. dermalogica/dermalogicadailymicrofoliant045oz.jpg Bonus Deal Available 9.00 12.60 12.60 False False False False 0.00 False False Diversion contract is required 0 Dermalogica daily microfoliant is a gentle, daily use exfoliating powder that sloughs away dead skin cells, instantly leaving skin smoother and brighter. For use with all skin conditions. True Log in to view pricing. False
    Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz.

    Dermalogica
    daily microfoliant - travel bright

    0.45 Fl. Oz.

    SKU 111248

    Bonus Offer
    Quick View
  • 133384 411453 411453 1 daily milkfoliant 0.45 Fl. Oz. Dermalogica Dermalogica daily milkfoliant 0.45 Fl. Oz. dermalogica/dermalogicadailymilkfoliant045oz.jpg Bonus Deal Available 9.00 12.60 12.60 False False False False 0.00 False False Diversion contract is required 0 Make peace with daily exfoliation. Dermalogica's daily milkfoliant exfoliator gently polishes to reveal smoother, more vibrant skin, replenishes and restores skin's moisture barrier and relieves skin with calming and soothing ingredients. True Log in to view pricing. False
    Dermalogica daily milkfoliant 0.45 Fl. Oz.

    Dermalogica
    daily milkfoliant

    0.45 Fl. Oz.

    SKU 411453

    Bonus Offer
    Quick View
  • 141352 611465 611465 1 retinol serum SAMPLE Dermalogica Dermalogica dynamic skin retinol serum SAMPLE dermalogica/dermalogicadynamicskinretinolserumsample.jpg Bonus Deal Available 0.70 0.98 0.98 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's dynamic skin retinol serum is a high-dose, fast-acting multi-retinoid with booster technology that helps reverse the appearance of wrinkles, retexturize skin and minimize the appearance of pores, and even skin tone. True Log in to view pricing. False
    Dermalogica retinol serum SAMPLE

    Dermalogica
    dynamic skin retinol serum

    SAMPLE

    SKU 611465

    Bonus Offer
    Quick View
  • 145276 911474-10 911474-10 1 oil to foam total cleanser 0.5 Fl. Oz. Dermalogica Dermalogica oil to foam total cleanser 0.5 Fl. Oz. dermalogica/dermalogicaoiltofoamtotalcleanser05oz.jpg Bonus Deal Available 6.00 8.40 8.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. True Log in to view pricing. False
    Dermalogica oil to foam total cleanser 0.5 Fl. Oz.

    Dermalogica
    oil to foam total cleanser

    0.5 Fl. Oz.

    SKU 911474-10

    Bonus Offer
    Quick View
  • 145276 611474 611474 1 oil to foam total cleanser SAMPLE Dermalogica Dermalogica oil to foam total cleanser SAMPLE dermalogica/dermalogicaoiltofoamtotalcleansersample.jpg Bonus Deal Available 0.60 0.84 0.84 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. False Log in to view pricing. False
    Dermalogica oil to foam total cleanser SAMPLE

    Dermalogica
    oil to foam total cleanser

    SAMPLE

    SKU 611474

    Bonus Offer
    Quick View
  • 144615 611466 611466 1 phyto nature oxygen liquid cream 0.07 Fl. Oz. Dermalogica Dermalogica phyto nature oxygen liquid cream 0.07 Fl. Oz. dermalogica/dermalogicaphytonatureoxygencreamsample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's phyto nature oxygen cream is a reawakening daily liquid moisturizer that firms, lifts, and revitalizes with premium hydrating and oxygen-optimizing phytoactives. True Log in to view pricing. False
    Dermalogica phyto nature oxygen liquid cream 0.07 Fl. Oz.

    Dermalogica
    phyto nature oxygen liquid cream

    0.07 Fl. Oz.

    SKU 611466

    Bonus Offer
    Quick View
  • 67732 111325 111325 1 skin smoothing cream 0.5 Fl. Oz. Dermalogica Dermalogica skin smoothing cream 0.5 Fl. Oz. dermalogica/111325dermalogicaskinsmoothingcreamtube.jpg Bonus Deal Available 8.50 11.90 11.90 False False False False 0.00 False False Diversion contract is required 0 Now with a continuous 48 hours of hydration, skin smoothing cream with Active Hydramesh Technology improves skin hydration by 80%, protects against environmental factors, and locks in moisture. True Log in to view pricing. False
    Dermalogica skin smoothing cream 0.5 Fl. Oz.

    Dermalogica
    skin smoothing cream

    0.5 Fl. Oz.

    SKU 111325

    Bonus Offer
    Quick View
(11 Items)