dermalogica

(13 Items)

19327 611596 611596 4 active moist SAMPLE Dermalogica Dermalogica active moist SAMPLE dermalogica/611596dermalogicaactivemoisttube.jpg Bonus Deal Available 0.20 0.28 0.28 False False False False 0.00 False False Diversion contract is required 0 Dermologica active moist is a light, oil-free lotion that helps improve skin texture and combat surface dehydration. True Log in to view pricing. False

Dermalogica
active moist

SAMPLE

SKU 611596

Log in to view pricing.
Quick View
19327 911397U 911397U 1 active moist trial 0.24 Fl. Oz. Dermalogica Dermalogica active moist trial 0.24 Fl. Oz. dermalogica/dermalogicaactivemoisttrial024.jpg Bonus Deal Available 6.00 8.40 8.40 False False False False 0.00 False False Diversion contract is required 0 Dermologica active moist is a light, oil-free lotion that helps improve skin texture and combat surface dehydration. True Log in to view pricing. False

Dermalogica
active moist trial

0.24 Fl. Oz.

SKU 911397U

Log in to view pricing.
Quick View
135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Bonus Deal Available 0.50 0.70 0.70 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

SAMPLE

SKU 611449

Log in to view pricing.
Quick View
101551 611431 611431 1 cooling aqua jelly moisturizer SAMPLE Dermalogica Dermalogica clear start cooling aqua jelly moisturizer SAMPLE dermalogica/dermalogicaclearstartcoolingaquajellysample.jpg Bonus Deal Available 1.60 2.24 2.24 False False False False 0.00 False False Diversion contract is required 0 Dermalogica clear start cooling aqua jelly is a weightless moisturizer that provides dewy hydration for oily skin. Achieve balanced hydration with all the glow and none of the shine. True Log in to view pricing. False

Dermalogica
clear start cooling aqua jelly moisturizer

SAMPLE

SKU 611431

Log in to view pricing.
Quick View
120828 611439 611439 1 daily glycolic cleanser SAMPLE Dermalogica Dermalogica daily glycolic cleanser SAMPLE dermalogica/demalogicadailyglycoliccleansersample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica daily glycolic cleanser is a brightening and conditioning cleanser that renews dull, uneven skin tone and helps remove buildup caused by environmental factors. True Log in to view pricing. False

Dermalogica
daily glycolic cleanser

SAMPLE

SKU 611439

Log in to view pricing.
Quick View
19307 111248 111248 1 daily microfoliant - travel bright 0.45 Fl. Oz. Dermalogica Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz. dermalogica/dermalogicadailymicrofoliant045oz.jpg Bonus Deal Available 9.00 12.60 12.60 False False False False 0.00 False False Diversion contract is required 0 Dermalogica daily microfoliant is a gentle, daily use exfoliating powder that sloughs away dead skin cells, instantly leaving skin smoother and brighter. For use with all skin conditions. True Log in to view pricing. False

Dermalogica
daily microfoliant - travel bright

0.45 Fl. Oz.

SKU 111248

Log in to view pricing.
Quick View
133384 411453 411453 1 daily milkfoliant 0.45 Fl. Oz. Dermalogica Dermalogica daily milkfoliant 0.45 Fl. Oz. dermalogica/dermalogicadailymilkfoliant045oz.jpg Bonus Deal Available 9.00 12.60 12.60 False False False False 0.00 False False Diversion contract is required 0 Make peace with daily exfoliation. Dermalogica's daily milkfoliant exfoliator gently polishes to reveal smoother, more vibrant skin, replenishes and restores skin's moisture barrier and relieves skin with calming and soothing ingredients. True Log in to view pricing. False

Dermalogica
daily milkfoliant

0.45 Fl. Oz.

SKU 411453

Log in to view pricing.
Quick View
141352 611465 611465 1 retinol serum SAMPLE Dermalogica Dermalogica dynamic skin retinol serum SAMPLE dermalogica/dermalogicadynamicskinretinolserumsample.jpg Bonus Deal Available 0.70 0.98 0.98 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's dynamic skin retinol serum is a high-dose, fast-acting multi-retinoid with booster technology that helps reverse the appearance of wrinkles, retexturize skin and minimize the appearance of pores, and even skin tone. True Log in to view pricing. False

Dermalogica
dynamic skin retinol serum

SAMPLE

SKU 611465

Log in to view pricing.
Quick View
145276 911474 911474 1 oil to foam total cleanser 0.5 Fl. Oz. Dermalogica Dermalogica oil to foam total cleanser 0.5 Fl. Oz. dermalogica/dermalogicaoiltofoamtotalcleanser05oz.jpg Bonus Deal Available 6.00 8.40 8.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. True Log in to view pricing. False

Dermalogica
oil to foam total cleanser

0.5 Fl. Oz.

SKU 911474

Log in to view pricing.
Quick View
145276 611474 611474 1 oil to foam total cleanser SAMPLE Dermalogica Dermalogica oil to foam total cleanser SAMPLE dermalogica/dermalogicaoiltofoamtotalcleansersample.jpg Bonus Deal Available 1.23 1.72 1.72 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. True Log in to view pricing. False

Dermalogica
oil to foam total cleanser

SAMPLE

SKU 611474

Log in to view pricing.
Quick View
144615 611466 611466 1 phyto nature oxygen liquid cream 0.07 Fl. Oz. Dermalogica Dermalogica phyto nature oxygen liquid cream 0.07 Fl. Oz. dermalogica/dermalogicaphytonatureoxygencreamsample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's phyto nature oxygen cream is a reawakening daily liquid moisturizer that firms, lifts, and revitalizes with premium hydrating and oxygen-optimizing phytoactives. True Log in to view pricing. False

Dermalogica
phyto nature oxygen liquid cream

0.07 Fl. Oz.

SKU 611466

Log in to view pricing.
Quick View
67732 111325 111325 1 skin smoothing cream 0.5 Fl. Oz. Dermalogica Dermalogica skin smoothing cream 0.5 Fl. Oz. dermalogica/111325dermalogicaskinsmoothingcreamtube.jpg Bonus Deal Available 8.50 11.90 11.90 False False False False 0.00 False False Diversion contract is required 0 Now with a continuous 48 hours of hydration, skin smoothing cream with Active Hydramesh Technology improves skin hydration by 80%, protects against environmental factors, and locks in moisture. True Log in to view pricing. False

Dermalogica
skin smoothing cream

0.5 Fl. Oz.

SKU 111325

Log in to view pricing.
Quick View
51845 5714 5714 1 sound sleep cocoon 0.34 Fl. Oz. Dermalogica Dermalogica sound sleep cocoon 0.34 Fl. Oz. dermalogica/dermalogica-travel-cap-on-sound-sleep-cocoon0.34oz.jpg Bonus Deal Available 1.00 1.40 1.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica sound sleep cocoon is a revitalizing night gel-cream treatment that transforms skin overnight by optimizing nighttime skin recovery. . False Log in to view pricing. False

Dermalogica
sound sleep cocoon

0.34 Fl. Oz.

SKU 5714

Log in to view pricing.
Quick View