hydropeptide targeted solutions

(18 Items)

50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False

HydroPeptide
Nimni Day Cream

1 Fl. Oz.

SKU 921552

Promotional ItemLog in to view pricing.
Quick View
51065 920258 920258 1 Radiance Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Radiance Mask 0.5 Fl. Oz. False hydropeptide/hpradiancemask.jpg Special Offer Available 24.00 24.00 14.40 True True False False 14.40 False False Diversion contract is required HydroPeptide Radiance Mask is a brightening and moisturizing mask that combines alpha-hydroxy acids, antioxidant-rich enzymes, and natural skin brighteners to reveal soft, even-toned, glowing skin. False Log in to view pricing. False

HydroPeptide
Radiance Mask

0.5 Fl. Oz.

SKU 920258

Promotional ItemLog in to view pricing.
Quick View
39411 920119 920119 1 5X Power Peel 30 pk. HydroPeptide HydroPeptide 5X Power Peel 30 pk. False hydropeptide/HydroP5xPowerPeelUpdate25.jpg Special Offer Available 36.50 36.50 36.50 False False False False 0.00 False False Diversion contract is required Hydropeptide 5X Power Peel resurfaces, clarifies, brightens, and smooths away the appearance of wrinkles with five powerful daily exfoliants. True Log in to view pricing. False

HydroPeptide
5X Power Peel

30 pk.

SKU 920119

Log in to view pricing.
Quick View
51028 920256 920256 1 Balancing Mask 1 Fl. Oz. HydroPeptide HydroPeptide Balancing Mask 1 Fl. Oz. False hydropeptide/newhypbalancingmask1oz.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Balancing Mask is a creamy clay-based age-defying mask that strengthens skin against environmental stressors and infuses it with the protective nutrients it needs to stay balanced, calm, hydrated, and youthful-looking. False Log in to view pricing. False

HydroPeptide
Balancing Mask

1 Fl. Oz.

SKU 920256

Log in to view pricing.
Quick View
135674 921378 921378 1 Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. HydroPeptide HydroPeptide Daily Drench Hyaluronic Acid Peptide Booster 1 Fl. Oz. False hydropeptide/newhypdailydrench1oz.jpg Special Offer Available 39.50 39.50 39.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Daily Drench Hyaluronic Acid Peptide is a one-of-a-kind treatment carefully formulated to deliver a thirst-quenching hit of triple-weight hyaluronic acid for maximum hydration. True Log in to view pricing. False

HydroPeptide
Daily Drench Hyaluronic Acid Peptide Booster

1 Fl. Oz.

SKU 921378

Log in to view pricing.
Quick View
68068 921235 921235 1 Firm-a-Fix Neck Nectar 1.7 Fl. Oz. HydroPeptide HydroPeptide Firm-a-Fix Neck Nectar 1.7 Fl. Oz. False hydropeptide/newhypfirmafixnectar1.7oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Firma-Fix Neck Nectar is designed specifically for use on your neck and décolleté. True Log in to view pricing. False

HydroPeptide
Firm-a-Fix Neck Nectar

1.7 Fl. Oz.

SKU 921235

Log in to view pricing.
Quick View
39571 920121 920121 1 Lumapro-C 1 Fl. Oz. HydroPeptide HydroPeptide Lumapro-C 1 Fl. Oz. True hydropeptide/newhyplumapro-c1oz.jpg Special Offer Available 74.50 74.50 74.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Lumapro-C is a spot-fading serum powered by a highly stable form of antioxidant-rich vitamin C that diminishes the appearance of existing hyperpigmentation while enhancing overall brightness to achieve ultimate radiance, clarity, and skin refinement. False Log in to view pricing. False

HydroPeptide
Lumapro-C

Log in to view pricing.
View Sizes
51029 920254 920254 1 Miracle Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Miracle Mask 0.5 Fl. Oz. True hydropeptide/hydropeptidemiraclemask.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Miracle Mask uses purifying clays to clear impurities while minimizing the appearance of pores, while peptides address the appearance of wrinkles and an advanced complex provides an immediate visible lift. True Log in to view pricing. False

HydroPeptide
Miracle Mask

Log in to view pricing.
View Sizes
39538 920122 920122 1 Perfecting Gloss - Beach Blush 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Beach Blush 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglossbeachblush.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False

HydroPeptide
Perfecting Gloss - Beach Blush

0.17 Fl. Oz.

SKU 920122

Log in to view pricing.
Quick View
39539 920124 920124 1 Perfecting Gloss - Berry Breeze 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Berry Breeze 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglossberrybreeze.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False

HydroPeptide
Perfecting Gloss - Berry Breeze

0.17 Fl. Oz.

SKU 920124

Log in to view pricing.
Quick View
39581 920123 920123 1 Perfecting Gloss - Nude Pearl 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Nude Pearl 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglossnudepearl.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False

HydroPeptide
Perfecting Gloss - Nude Pearl

0.17 Fl. Oz.

SKU 920123

Log in to view pricing.
Quick View
39611 920127 920127 1 Perfecting Gloss - Santorini Red 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Santorini Red 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglosssantorinired.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False

HydroPeptide
Perfecting Gloss - Santorini Red

0.17 Fl. Oz.

SKU 920127

Log in to view pricing.
Quick View
39665 920126 920126 1 Perfecting Gloss - Sunkissed 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Sunkissed 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglosssunkissedbronze.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False

HydroPeptide
Perfecting Gloss - Sunkissed

0.17 Fl. Oz.

SKU 920126

Log in to view pricing.
Quick View
89519 921283 921283 1 Perfecting Gloss- Palm Springs Pink 0.16 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss- Palm Springs Pink 0.16 Fl. Oz. False hydropeptide/newhydropeptideperfectingglosspalmspringspink.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False

HydroPeptide
Perfecting Gloss- Palm Springs Pink

0.16 Fl. Oz.

SKU 921283

Log in to view pricing.
Quick View
39589 920118 920118 1 Polish & Plump Peel 2 pc. HydroPeptide HydroPeptide Polish & Plump Peel 2 pc. False hydropeptide/hypnewpolishplump2pc.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Polish & Plump Peel provides the benefits of a gentle microdermabrasion, a light chemical peel and a pampering facial in just two easy steps. True Log in to view pricing. False

HydroPeptide
Polish & Plump Peel

2 pc.

SKU 920118

Log in to view pricing.
Quick View