Mar/Apr 25 Promos

hydropeptide

(135 Items)
  • 161602 921502 921502 1 Glow Like a Pro Set 6 pc. HydroPeptide HydroPeptide Glow Like a Pro Set 6 pc. False hydropeptide/hypglowlikeaprokitupdate.jpg Special Offer Available 42.00 42.00 16.80 True True False False 16.80 False False Diversion contract is required 0 HydroPeptide Glow Like a Pro Set is for radical brightening benefits and renewed radiance in minutes. True Log in to view pricing. False
    HydroPeptide Glow Like a Pro Set 6 pc.

    HydroPeptide
    Glow Like a Pro Set

    6 pc.

    SKU 921502

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 152730 921456 921456 1 Glow Revive Body Wash 8 Fl. Oz. HydroPeptide HydroPeptide Glow Revive Body Wash 8 Fl. Oz. False hydropeptide/newhypbrighteningbodycollectionglowrevive8oz.jpg Special Offer Available 22.50 22.50 17.50 True True False False 17.50 False False Diversion contract is required 0 HydroPeptide Glow Revive Body Wash cleanses, brightens, exfoliates, and uses the revitalizing power of caffeine alongside shikimic acid, a gentle yet highly effective chemical exfoliant that boasts 10 times the biological activity of glycolic acid, to deeply nourish and visibly rejuvenate skin. True Log in to view pricing. False
    HydroPeptide Glow Revive Body Wash 8 Fl. Oz.

    HydroPeptide
    Glow Revive Body Wash

    8 Fl. Oz.

    SKU 921456

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 42471 920132 920132 1 Nimni Cream 0.5 Fl. Oz. HydroPeptide HydroPeptide Nimni Cream 0.5 Fl. Oz. True hydropeptide/newhydropeptidenimnicream05oz.jpg Special Offer Available 56.00 56.00 40.00 True True False False 40.00 False False Diversion contract is required 0 HydroPeptide Nimni Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimniâ„¢ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False
    HydroPeptide Nimni Cream 0.5 Fl. Oz.

    HydroPeptide
    Nimni Cream

    Bonus Offer
    Promotional ItemLog in to view pricing.
    View Sizes
  • 50655 920257 920257 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 56.00 56.00 40.00 True True False False 40.00 False False Diversion contract is required 0 HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimniâ„¢ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False
    HydroPeptide Nimni Day Cream 1 Fl. Oz.

    HydroPeptide
    Nimni Day Cream

    1 Fl. Oz.

    SKU 920257

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 168357 921534 921534 1 Sun Slick 0.52 Fl. Oz. HydroPeptide HydroPeptide Sun Slick 0.52 Fl. Oz. False hydropeptide/hydropeptidesunslickstick2025.jpg Special Offer Available 19.00 19.00 19.00 False True Valid Thru 04/30/25 False False 0.00 False False Diversion contract is required 0 HydroPeptide Sun Slick is enriched with reparative peptides, hydrating lipids, and SPF-supporting ingredients, making this is your ultimate companion for healthy, protected skin at home or on the go. True Log in to view pricing. False
    HydroPeptide Sun Slick 0.52 Fl. Oz.

    HydroPeptide
    Sun Slick

    0.52 Fl. Oz.

    SKU 921534

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 39411 920119 920119 1 5X Power Peel 30 pk. HydroPeptide HydroPeptide 5X Power Peel 30 pk. False hydropeptide/HydroP5xPowerPeelUpdate25.jpg Special Offer Available 36.50 36.50 36.50 False False False False 0.00 False False Diversion contract is required 0 Hydropeptide 5X Power Peel resurfaces, clarifies, brightens, and smooths away the appearance of wrinkles with five powerful daily exfoliants. True Log in to view pricing. False
    HydroPeptide 5X Power Peel 30 pk.

    HydroPeptide
    5X Power Peel

    30 pk.

    SKU 920119

    Bonus Offer
    Quick View
  • 156536 921450 921450 1 Age Reversal Regimen 6 pc. HydroPeptide HydroPeptide Age Reversal Regimen 6 pc. False hydropeptide/HydroPeptideAgeReversalRegimen.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required 0 Hydropeptide Age Reversal Regimen features six best-selling products, one holistic routine for visibly rejuvenated skin.
    Includes 1 Each:
    Exfoliating Cleanser 1 oz.
    Power Serum 0.34 oz.
    Eye Authority 0.17 oz.
    Power Lift Moisturizer 0.17 oz.
    Nimni Cream Collagen Complex 0.17 oz.
    Solar Defense Tinted SPF 30 0.5 oz.
    True Log in to view pricing. False
    HydroPeptide Age Reversal Regimen 6 pc.

    HydroPeptide
    Age Reversal Regimen

    6 pc.

    SKU 921450

    Bonus Offer
    Quick View
  • 70656 920149 920149 1 Hydraflora Probiotic Essence 4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydraflora Probiotic Essence 4 Fl. Oz. False hydropeptide/hypnewhydraflora4oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Hydraflora Probiotic Essence Toner is formulated with a powerful pre- and probiotic complex to help maintain healthy microflora and provide skin barrier support. True Log in to view pricing. False
    HydroPeptide Hydraflora Probiotic Essence 4 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Detox Hydraflora Probiotic Essence

    4 Fl. Oz.

    SKU 920149

    Bonus Offer
    Quick View
  • 73646 920356 920356 1 Hydroactive Cleanse Micellar Facial Cloths 30 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 30 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required 0 Remove build-up and deeply purify with HydroPeptide Micellar Cleansing Cloths. True Log in to view pricing. False
    HydroPeptide Hydroactive Cleanse Micellar Facial Cloths 30 pk.

    HydroPeptide
    Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

    30 pk.

    SKU 920356

    Bonus Offer
    Quick View
  • 70659 920152 920152 1 Hydroactive Cleanse Micellar Facial Cloths 5 pk. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths 5 pk. False hydropeptide/hydropeptidehydroactivecleansemicellarfacialcloths30treatments.jpg Special Offer Available 50.00 50.00 50.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Hydroactive Cleanse Micellar Facial Cloths gently remove makeup, debris and pollution while purifying the skin in one sweep. True Log in to view pricing. False
    HydroPeptide Hydroactive Cleanse Micellar Facial Cloths 5 pk.

    HydroPeptide
    Anti-Wrinkle + Detox Hydroactive Cleanse Micellar Facial Cloths

    5 pk.

    SKU 920152

    Bonus Offer
    Quick View
  • 70661 920270 920270 1 Honey Tri-zyme Peel Regenerating Exfoliant 4 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Professional Honey Tri-zyme Peel Regenerating Exfoliant 4 Fl. Oz. False hydropeptideprofessional/hpphoneytrizyme.jpg Special Offer Available 52.00 52.00 52.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Honey Tri-zyme Peel Regenerating Exfoliant is a gentle yet highly effective peel formulated with a specialized blend of botanical enzymes, raw honey, and natural alpha-hydroxy acids to perfectly resurface, hydrate, and smooth skin. True Log in to view pricing. False
    HydroPeptide Honey Tri-zyme Peel Regenerating Exfoliant 4 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Detox Professional Honey Tri-zyme Peel Regenerating Exfoliant

    4 Fl. Oz.

    SKU 920270

    Bonus Offer
    Quick View
  • 70660 920269 920269 1 Hydraflora Probiotic Essence 12 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Professional Hydraflora Probiotic Essence 12 Fl. Oz. False hydropeptide/HYPNewProPackagingHydraFlora12oz.jpg Special Offer Available 50.00 50.00 50.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Hydraflora Probiotic Essence Toner is formulated with a powerful pre- and probiotic complex to help maintain healthy microflora and provide skin barrier support. True Log in to view pricing. False
    HydroPeptide Hydraflora Probiotic Essence 12 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Detox Professional Hydraflora Probiotic Essence

    12 Fl. Oz.

    SKU 920269

    Bonus Offer
    Quick View
  • 70662 920271 920271 1 Nordic Detox Mask 6 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Professional Nordic Detox Mask 6 Fl. Oz. False hydropeptideprofessional/hydropeptidenordicdetoxmask.jpg Special Offer Available 52.00 52.00 52.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Nordic Detox Mask is a soothing clay mask, packed with phytonutrient-dense Nordic Peat and works to draw dirt and pollution out from deep within the pores while nourishing and infusing skin with plumping hydration for a smooth, balanced look and feel. True Log in to view pricing. False
    HydroPeptide Nordic Detox Mask 6 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Detox Professional Nordic Detox Mask

    6 Fl. Oz.

    SKU 920271

    Bonus Offer
    Quick View
  • 127117 921361 921361 1 Triple Acid Peptide Peel 1 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Detox Triple Acid Peptide Peel 1 Fl. Oz. True hydropeptide/hydropeptidetripleacidpeel1oz30ml.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Triple Acid Peptide Peel is a leave-on face peel designed to encourage cell turnover and improve signs of aging. True Log in to view pricing. False
    HydroPeptide Triple Acid Peptide Peel 1 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Detox Triple Acid Peptide Peel

    Bonus Offer
    View Sizes
  • 84664 921254 921254 1 Cashmere Cleanse 6.76 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Cashmere Cleanse 6.76 Fl. Oz. True hydropeptide/hypnewcashmerecleanse6oz.jpg Special Offer Available 27.00 27.00 27.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Cashmere Cleanser is a comforting cleanser that gently whisks away impurities without stripping or drying the skin. True Log in to view pricing. False
    HydroPeptide Cashmere Cleanse 6.76 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Cashmere Cleanse

    Bonus Offer
    View Sizes
(135 Items)