travel/minis skin & body

(41 Items)
  • 42471 921529 921529 1 Nimni Cream Travel 0.17 Fl. Oz. HydroPeptide HydroPeptide Nimni Cream Travel 0.17 Fl. Oz. hydropeptide/hydropeptidenimnicream017oz.jpg Special Offer Available 22.50 22.50 15.00 True True False False 15.00 False False Diversion contract is required HydroPeptide Nimni Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimniâ„¢ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False
    HydroPeptide Nimni Cream Travel 0.17 Fl. Oz.

    HydroPeptide
    Nimni Cream Travel

    0.17 Fl. Oz.

    SKU 921529

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 138993 76587 76587 1 HAND CREAM AMBRE NOIR 1.35 Fl. Oz. MOROCCANOIL MOROCCANOIL HAND CREAM AMBRE NOIR 1.35 Fl. Oz. moroccanoil/moroccanoilhandcreamambernoir1oz.jpg Special Offer Available 6.00 6.00 4.20 True True False False 4.20 False False Diversion contract is required MOROCCANOIL HAND CREAM AMBRE NOIR intensely nourishes hands, nails, and cuticles with the Hand Cream collection. True Log in to view pricing. False
    MOROCCANOIL HAND CREAM AMBRE NOIR 1.35 Fl. Oz.

    MOROCCANOIL
    HAND CREAM AMBRE NOIR

    1.35 Fl. Oz.

    SKU 76587

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 138994 76593 76593 1 HAND CREAM OUD MINÉRAL 1.35 Fl. Oz. MOROCCANOIL MOROCCANOIL HAND CREAM OUD MINÉRAL 1.35 Fl. Oz. moroccanoil/moroccanoilhandcreamoudmineral1oz.jpg Special Offer Available 6.00 6.00 4.20 True True False False 4.20 False False Diversion contract is required MOROCCANOIL HAND CREAM OUD MINÉRAL intensely nourishes hands, nails, and cuticles with the Hand Cream collection. True Log in to view pricing. False
    MOROCCANOIL HAND CREAM OUD MINÉRAL 1.35 Fl. Oz.

    MOROCCANOIL
    HAND CREAM OUD MINÉRAL

    1.35 Fl. Oz.

    SKU 76593

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 169250 211496 211496 1 restore moisturizer 2 Fl. Oz. Dermalogica Dermalogica pro only restore moisturizer 2 Fl. Oz. dermalogica/dermalogicaprorestoremoisturizer2oz.jpg Special Offer Available 91.00 91.00 91.00 False True Valid Thru 05/31/25 False False 91.00 False False Diversion contract is required Dermalogica PRO restore moisturizer uses Hyaluronic Acid complex to distribute hydration throughout the skin, helping to lock in moisture. True Log in to view pricing. False
    Dermalogica restore moisturizer 2 Fl. Oz.

    Dermalogica
    pro only restore moisturizer

    2 Fl. Oz.

    SKU 211496

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 169251 211495 211495 1 restore serum 1 Fl. Oz. Dermalogica Dermalogica pro only restore serum 1 Fl. Oz. dermalogica/dermalogicaprorestoreserum1oz.jpg Special Offer Available 105.00 105.00 105.00 False True Valid Thru 05/31/25 False False 105.00 False False Diversion contract is required Dermalogica PRO restore serum supports skin recovery, firms, replenishes, and brightens. True Log in to view pricing. False
    Dermalogica restore serum 1 Fl. Oz.

    Dermalogica
    pro only restore serum

    1 Fl. Oz.

    SKU 211495

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 169252 211497 211497 1 restore eye gel cream 0.5 Fl. Oz. Dermalogica Dermalogica restore eye gel cream 0.5 Fl. Oz. dermalogica/dermalogicaprorestoreeyegelcream0.5oz.jpg Special Offer Available 63.00 63.00 63.00 False True Valid Thru 05/31/25 False False 63.00 False False Diversion contract is required Dermalogica PRO restore eye gel cream is an active, cooling gel-cream that restores barrier function and reduces visible signs of stress. True Log in to view pricing. False
    Dermalogica restore eye gel cream 0.5 Fl. Oz.

    Dermalogica
    restore eye gel cream

    0.5 Fl. Oz.

    SKU 211497

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 19327 611596 611596 4 active moist SAMPLE Dermalogica Dermalogica active moist SAMPLE dermalogica/611596dermalogicaactivemoisttube.jpg Special Offer Available 0.22 0.22 0.22 False False False False 0.22 False False Diversion contract is required Dermologica active moist is a light, oil-free lotion that helps improve skin texture and combat surface dehydration. True Log in to view pricing. False
    Dermalogica active moist SAMPLE

    Dermalogica
    active moist

    SAMPLE

    SKU 611596

    Bonus Offer
    Quick View
  • 164315 611507 611507 1 multivitamin power recovery cream 0.07 Fl. Oz. Dermalogica Dermalogica age smart multivitamin power recovery cream 0.07 Fl. Oz. dermalogica/dmmultivitaminpowerrecoverycream0.07floz.jpg Special Offer Available 0.88 0.88 0.88 False False False False 0.88 False False Diversion contract is required Dermalogica age smart multivitamin power recovery cream is an antioxidant-rich moisturizer that is clinically proven to treat four signs of stressed skin after one use. True Log in to view pricing. False
    Dermalogica multivitamin power recovery cream 0.07 Fl. Oz.

    Dermalogica
    age smart multivitamin power recovery cream

    0.07 Fl. Oz.

    SKU 611507

    Bonus Offer
    Quick View
  • 164614 911507 911507 1 multivitamin power recovery cream Trial 0.17 Fl. Oz. Dermalogica Dermalogica age smart multivitamin power recovery cream Trial 0.17 Fl. Oz. dermalogica/dmmultivitaminpowerrecoverycream0.17floz.jpg Special Offer Available 9.35 9.35 9.35 False False False False 9.35 False False Diversion contract is required Dermalogica age smart multivitamin power recovery cream is an antioxidant-rich moisturizer that is clinically proven to treat four signs of stressed skin after one use. True Log in to view pricing. False
    Dermalogica multivitamin power recovery cream Trial 0.17 Fl. Oz.

    Dermalogica
    age smart multivitamin power recovery cream Trial

    0.17 Fl. Oz.

    SKU 911507

    Bonus Offer
    Quick View
  • 135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Special Offer Available 0.44 0.44 0.44 False False False False 0.44 False False Diversion contract is required Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False
    Dermalogica awaken peptide eye gel SAMPLE

    Dermalogica
    awaken peptide eye gel

    SAMPLE

    SKU 611449

    Bonus Offer
    Quick View
  • 130309 611455 611455 1 Circular Hydration Serum Sample 0.03 Fl. Oz. Dermalogica Dermalogica Circular Hydration Serum Sample 0.03 Fl. Oz. dermalogica/dermalogicacircularhydrationserumsample.jpg Special Offer Available 0.44 0.44 0.44 False False False False 0.44 False False Diversion contract is required Dermalogica circular hydration serum immediately floods skin with hydration, replenishes from within, and helps prevent future hydration evaporation. True Log in to view pricing. False
    Dermalogica Circular Hydration Serum Sample 0.03 Fl. Oz.

    Dermalogica
    Circular Hydration Serum Sample

    0.03 Fl. Oz.

    SKU 611455

    Bonus Offer
    Quick View
  • 120828 611439 611439 1 daily glycolic cleanser SAMPLE Dermalogica Dermalogica daily glycolic cleanser SAMPLE dermalogica/demalogicadailyglycoliccleansersample.jpg Special Offer Available 0.44 0.44 0.44 False False False False 0.44 False False Diversion contract is required Dermalogica daily glycolic cleanser is a brightening and conditioning cleanser that renews dull, uneven skin tone and helps remove buildup caused by environmental factors. True Log in to view pricing. False
    Dermalogica daily glycolic cleanser SAMPLE

    Dermalogica
    daily glycolic cleanser

    SAMPLE

    SKU 611439

    Bonus Offer
    Quick View
  • 19307 111248 111248 1 daily microfoliant - travel bright 0.45 Fl. Oz. Dermalogica Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz. dermalogica/dermalogicadailymicrofoliant045oz.jpg Special Offer Available 13.30 13.30 13.30 False False False False 13.30 False False Diversion contract is required Dermalogica daily microfoliant is a gentle, daily use exfoliating powder that sloughs away dead skin cells, instantly leaving skin smoother and brighter. For use with all skin conditions. True Log in to view pricing. False
    Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz.

    Dermalogica
    daily microfoliant - travel bright

    0.45 Fl. Oz.

    SKU 111248

    Bonus Offer
    Quick View
  • 133384 411453 411453 1 daily milkfoliant 0.45 Fl. Oz. Dermalogica Dermalogica daily milkfoliant 0.45 Fl. Oz. dermalogica/dermalogicadailymilkfoliant045oz.jpg Special Offer Available 13.30 13.30 13.30 False False False False 13.30 False False Diversion contract is required Make peace with daily exfoliation. Dermalogica's daily milkfoliant exfoliator gently polishes to reveal smoother, more vibrant skin, replenishes and restores skin's moisture barrier and relieves skin with calming and soothing ingredients. True Log in to view pricing. False
    Dermalogica daily milkfoliant 0.45 Fl. Oz.

    Dermalogica
    daily milkfoliant

    0.45 Fl. Oz.

    SKU 411453

    Bonus Offer
    Quick View
  • 141352 611465 611465 1 retinol serum SAMPLE Dermalogica Dermalogica dynamic skin retinol serum SAMPLE dermalogica/dermalogicadynamicskinretinolserumsample.jpg Special Offer Available 0.77 0.77 0.77 False False False False 0.77 False False Diversion contract is required Dermalogica's dynamic skin retinol serum is a high-dose, fast-acting multi-retinoid with booster technology that helps reverse the appearance of wrinkles, retexturize skin and minimize the appearance of pores, and even skin tone. True Log in to view pricing. False
    Dermalogica retinol serum SAMPLE

    Dermalogica
    dynamic skin retinol serum

    SAMPLE

    SKU 611465

    Bonus Offer
    Quick View
(41 Items)