Mar/Apr 25 Promos
Home cosmeticslips
Can't find a Product?

cosmetics lips

CATEGORY GENERIC Single Cosmetics
(24 Items)
  • 153783 BodyColorCassetteLiquid BodyColorCassetteLiquid 1 Color Cassette Liquid Blush Lip 0.19 Fl. Oz. bodyography bodyography Color Cassette Liquid Blush Lip 0.19 Fl. Oz. False bodyographycosmetics/bdgycolorcassetteliquidblushlip.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 bodyography Color Cassette Liquid Blush Lip is a skincare-infused, multi-tasking liquid blush + lip product; it effortlessly blends and layers for your desired intensity. True Log in to view pricing. False
    bodyography Color Cassette Liquid Blush Lip

    bodyography
    Color Cassette Liquid Blush Lip
    Bonus Offer
    Log in to view pricing.
    View Details
  • 131991 BG Fabric Lip Stick BG Fabric Lip Stick 1 Fabric Texture Lipstick Click to View Colors bodyography bodyography Fabric Texture Lipstick Click to View Colors False bodyography/bodyographyfabrictexturelipstickmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 bodyography's Fabric Texture Lipstick is a demi-matte lipstick that is light as air with rich, sumptuous color payoff and a next-to-nothing naked feel. True Log in to view pricing. False
    bodyography Fabric Texture Lipstick

    bodyography
    Fabric Texture Lipstick
    Bonus Offer
    Log in to view pricing.
    View Details
  • 132944 BG Lip Gloss BG Lip Gloss 1 Lip Gloss Click to View Colors bodyography bodyography Lip Gloss Click to View Colors False bodyography/bodyographylipglossmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 bodyography's Lip Gloss is a moisturizing, non-sticky gloss that looks as good as it feels! True Log in to view pricing. False
    bodyography Lip Gloss

    bodyography
    Lip Gloss
    Bonus Offer
    Log in to view pricing.
    View Details
  • 133236 BGLipGlossTESTER BGLipGlossTESTER 1 Lip Gloss TESTER Click to View Colors bodyography bodyography Lip Gloss TESTER Click to View Colors False bodyography/bodyographylipglossmastertester.png Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 bodyography's Lip Gloss is a moisturizing, non-sticky gloss that looks as good as it feels! True Log in to view pricing. False
    bodyography Lip Gloss TESTER

    bodyography
    Lip Gloss TESTER
    Bonus Offer
    Log in to view pricing.
    View Details
  • 85646 BO Lip Lava Liquid Lipsti BO Lip Lava Liquid Lipsti 1 Lip Lava Liquid Lipstick Click to View Colors bodyography bodyography Lip Lava Liquid Lipstick Click to View Colors False bodyography/bodyographyliplavalipstickmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 The bright, bold, ultra-soft matte and metallic finishes of bodyography's Lip Lava Liquid Lipstick go on opaque and dry instantly. True Log in to view pricing. False
    bodyography Lip Lava Liquid Lipstick

    bodyography
    Lip Lava Liquid Lipstick
    Bonus Offer
    Log in to view pricing.
    View Details
  • 133083 BOLipLavaLipstickTESTER BOLipLavaLipstickTESTER 1 Lip Lava Liquid Lipstick TESTER Click to View Colors bodyography bodyography Lip Lava Liquid Lipstick TESTER Click to View Colors False bodyography/bodyographyliplavalipstickmastertester.png Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 The bright, bold, ultra-soft matte and metallic finishes of bodyography's Lip Lava Liquid Lipstick go on opaque and dry instantly. True Log in to view pricing. False
    bodyography Lip Lava Liquid Lipstick TESTER

    bodyography
    Lip Lava Liquid Lipstick TESTER
    Bonus Offer
    Log in to view pricing.
    View Details
  • 131881 BG Lip Pencil BG Lip Pencil 1 Lip Pencil Click to View Colors bodyography bodyography Lip Pencil Click to View Colors False bodyography/bodyographylippencilmaster.jpg Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 bodyography Lip Pencil glides on like your favorite lipstick with precise, pigment-rich color to frame, fill in, and define lips. True Log in to view pricing. False
    bodyography Lip Pencil

    bodyography
    Lip Pencil
    Bonus Offer
    Log in to view pricing.
    View Details
  • 131966 BG Lip Stick BG Lip Stick 1 Lipstick Click to View Colors bodyography bodyography Lipstick Click to View Colors False bodyography/lipstick_maplesugar_swatch_web_1024x1024.png Special Offer Available 0.00 0.00 0.00 False False False False 0.00 True False Diversion contract is required 0 bodyography's Lipstick is long-lasting, super-pigmented formula contains a moisturizing Aloe Vera-base to help protect the lips from signs of aging. True Log in to view pricing. False
    bodyography Lipstick

    bodyography
    Lipstick
    Bonus Offer
    Log in to view pricing.
    View Details
  • 27428 GrandeLips GrandeLips 1 Hydrating Lip Plumper Click to View Colors Grande Cosmetics Grande Cosmetics GrandeLIPS Hydrating Lip Plumper Click to View Colors False grandecosmetics/grandelipsplumperv2.jpg Special Offer Available 13.50 13.50 13.50 False False False False 0.00 True False Diversion contract is required 0 GrandeLIPS is a high gloss, volumizing lip plumper infused with a nourishing cocktail of Volulip™ and hyaluronic acid for instant and long-term hydrating benefits. True Log in to view pricing. False
    Grande Cosmetics Hydrating Lip Plumper

    Grande Cosmetics
    GrandeLIPS Hydrating Lip Plumper
    Bonus Offer
    Log in to view pricing.
    View Details
  • 84676 921256 921256 1 Lip Service Hydrating Line Lifter 0.34 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Lip Service Hydrating Line Lifter 0.34 Fl. Oz. False hydropeptide/newhyplipservice0.34oz.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Lip Service Hydrating Line Lifter hydrates, voluminizes, and revives with an advanced anti-aging treatment for lips that combines plumping peptides with moisturizing and smoothing fruit extracts for instant relief from dryness and flaking. True Log in to view pricing. False
    HydroPeptide Lip Service Hydrating Line Lifter 0.34 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore Lip Service Hydrating Line Lifter

    0.34 Fl. Oz.

    SKU 921256
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 84685 921257 921257 1 LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz. True hydropeptide/hydropeptideliplockhydrator0.24oz.jpg Special Offer Available 21.00 21.00 21.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide LipLock Hydrator Peptide Infused Lip Mask provides softer, plumper-looking lips day or night with natural oils that dramatically boost hydration while peptides visibly improve volume and reduce the appearance of lip lines True Log in to view pricing. False
    HydroPeptide LipLock Hydrator Peptide Infused Lip Mask 0.24 Fl. Oz.

    HydroPeptide
    Anti-Wrinkle + Restore LipLock Hydrator Peptide Infused Lip Mask
    Bonus Offer
    Log in to view pricing.
    View Sizes
  • 39538 920122 920122 1 Perfecting Gloss - Beach Blush 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Beach Blush 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglossbeachblush.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False
    HydroPeptide Perfecting Gloss - Beach Blush 0.17 Fl. Oz.

    HydroPeptide
    Perfecting Gloss - Beach Blush

    0.17 Fl. Oz.

    SKU 920122
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 39539 920124 920124 1 Perfecting Gloss - Berry Breeze 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Berry Breeze 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglossberrybreeze.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False
    HydroPeptide Perfecting Gloss - Berry Breeze 0.17 Fl. Oz.

    HydroPeptide
    Perfecting Gloss - Berry Breeze

    0.17 Fl. Oz.

    SKU 920124
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 39581 920123 920123 1 Perfecting Gloss - Nude Pearl 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Nude Pearl 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglossnudepearl.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False
    HydroPeptide Perfecting Gloss - Nude Pearl 0.17 Fl. Oz.

    HydroPeptide
    Perfecting Gloss - Nude Pearl

    0.17 Fl. Oz.

    SKU 920123
    Bonus Offer
    Log in to view pricing.
    Quick View
  • 39611 920127 920127 1 Perfecting Gloss - Santorini Red 0.17 Fl. Oz. HydroPeptide HydroPeptide Perfecting Gloss - Santorini Red 0.17 Fl. Oz. False hydropeptide/newhydropeptideperfectingglosssantorinired.jpg Special Offer Available 19.50 19.50 19.50 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Perfecting Lip Gloss restores lip fullness, volume, and definition in minutes while enhancing long-lasting suppleness and hydration. True Log in to view pricing. False
    HydroPeptide Perfecting Gloss - Santorini Red 0.17 Fl. Oz.

    HydroPeptide
    Perfecting Gloss - Santorini Red

    0.17 Fl. Oz.

    SKU 920127
    Bonus Offer
    Log in to view pricing.
    Quick View
(24 Items)