Sept Trending Guide


(18 Items)
  • 130964 12300 12300 1 Professional Beach Wave System 5 pc. Cali-Curl Cali-Curl Professional Beach Wave System 5 pc. False calicurl/calicurlbeachwavesystem.jpg Bonus Deal Available 30.00 30.00 30.00 False False False 0.00 False False Diversion contract is required 0 The Cali-Curl Professional Beach Wave System is a single-use kit designed to be used alongside the Cali-Curl Rings and Foam Diffuser Rings during the Cali-Curl Service.
    1 Cali-Curl Beach Wave Activator 4 oz.
    1 Cali-Curl Beach Wave Neutralizer 4 oz.
    2 Cali-Curl Bond Generator 0.5 oz.
    1 Cali-Curl Bond Extender 1.69 oz.

    True Log in to view pricing. False
    Cali-Curl Professional Beach Wave System 5 pc.

    Professional Beach Wave System

    5 pc.

    SKU 12300

    Quick View
  • 137694 12329 12329 1 Buy 8 Beach Wave Systems, Get Retail Items FREE 13 pc. Cali-Curl Cali-Curl Buy 8 Beach Wave Systems, Get Retail Items FREE 13 pc. False calicurl/calicurlb8beachwavesystemsgretailitemsfree.jpg Bonus Deal Available 240.00 240.00 240.00 False True Valid Thru 10/31/22 False 0.00 False False Diversion contract is required 0 Cali-Curl Buy 8 Beach Wave Systems, Get Retail Items FREE includes system, shampoo, conditioner, mist, mask, and serum.
    Purchase 8:
    Beach Wave Systems
    (Each Includes: 1 Beach Wave Activator 4 oz., 1 Beach Wave Neutralizer 4 oz., 2 Bond Generator 0.5 oz., 1 Bond Extender 1.69 oz.)
    Receive 1 Each FREE:
    Hydrating Shampoo 10 oz.
    Protein Infused Conditioner 10 oz.
    Bond Therapy Mist 8 oz.
    Bond Therapy Masque 6 oz.
    Anti-Flyaway Serum 8 oz.
    True Log in to view pricing. False
    Cali-Curl Buy 8 Beach Wave Systems, Get Retail Items FREE 13 pc.

    Buy 8 Beach Wave Systems, Get Retail Items FREE

    13 pc.

    SKU 12329

    Promotional ItemLog in to view pricing.
    Quick View
  • 138788 12341 12341 1 Try Me Box 36 pc. Cali-Curl Cali-Curl Try Me Box 36 pc. False calicurl/calicurlprimeintro.jpg Bonus Deal Available 500.00 500.00 500.00 False True Valid Thru 10/31/22 False 0.00 False False Diversion contract is required 0 Cali-Curl Try Me Box includes system, rings, shampoo, conditioner, mist, mask and serum. True Log in to view pricing. False
    Cali-Curl Try Me Box 36 pc.

    Try Me Box

    36 pc.

    SKU 12341

    Promotional ItemLog in to view pricing.
    Quick View
  • 130991 12315 12315 1 Anti-Flyaway Serum 8 Fl. Oz. Cali-Curl Cali-Curl Anti-Flyaway Serum 8 Fl. Oz. False calicurl/calicurlantiflyawayserum.jpg Bonus Deal Available 14.00 14.00 14.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Anti-Flyaway Serum is a daily-use lightweight serum with just a little bit of hold specially designed to tame flyaway hair through conditioning agents and active bond repairing ingredients. True Log in to view pricing. False
    Cali-Curl Anti-Flyaway Serum 8 Fl. Oz.

    Anti-Flyaway Serum

    8 Fl. Oz.

    SKU 12315

    Quick View
  • 130978 12304 12304 1 Beach Wave Rings - Large 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Large 6 pc. False calicurl/calicurlbeachwaveringslarge.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Large work best to achieve a looser volumizing wave on long hair. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    True Log in to view pricing. False
    Cali-Curl Beach Wave Rings - Large 6 pc.

    Beach Wave Rings - Large

    6 pc.

    SKU 12304

    Quick View
  • 130975 12302 12302 1 Beach Wave Rings - Medium 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Medium 6 pc. False calicurl/calicurlbeachwavesmedium.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Medium work best to achieve a classic wave pattern. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    True Log in to view pricing. False
    Cali-Curl Beach Wave Rings - Medium 6 pc.

    Beach Wave Rings - Medium

    6 pc.

    SKU 12302

    Quick View
  • 130976 12303 12303 1 Beach Wave Rings - Medium+ 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Medium+ 6 pc. False calicurl/calicurlbeachwavesringsmedium.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Medium+ work best work best with longer/thicker hair to achieve a classic wave pattern. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    True Log in to view pricing. False
    Cali-Curl Beach Wave Rings - Medium+ 6 pc.

    Beach Wave Rings - Medium+

    6 pc.

    SKU 12303

    Quick View
  • 130969 12301 12301 1 Beach Wave Rings - Small 6 pc. Cali-Curl Cali-Curl Beach Wave Rings - Small 6 pc. False calicurl/calicurlbeachwaveringssmall.jpg Bonus Deal Available 35.00 35.00 35.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Beach Wave Rings - Small work best with short or layered hair. These patented waving tools are designed to achieve beautiful beach waves, volume and texture.

    True Log in to view pricing. False
    Cali-Curl Beach Wave Rings - Small 6 pc.

    Beach Wave Rings - Small

    6 pc.

    SKU 12301

    Quick View
  • 130988 12314 12314 1 Bond Therapy Masque 6 Fl. Oz. Cali-Curl Cali-Curl Bond Therapy Masque 6 Fl. Oz. False calicurl/calicurltherapymasque.jpg Bonus Deal Available 16.00 16.00 16.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Bond Therapy Masque is a luxurious deep conditioning and patented bond reparative masque to use at home, once each week or anytime your hair needs an extra hydrating boost. True Log in to view pricing. False
    Cali-Curl Bond Therapy Masque 6 Fl. Oz.

    Bond Therapy Masque

    6 Fl. Oz.

    SKU 12314

    Quick View
  • 130994 12313 12313 1 Bond Therapy Mist 8 Fl. Oz. Cali-Curl Cali-Curl Bond Therapy Mist 8 Fl. Oz. False calicurl/calicurlbondtherapymist.jpg Bonus Deal Available 14.00 14.00 14.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Bond Therapy Mist is a daily-use sprayable patented bond repair primer that detangles, protects against elements and strengthens the hair. True Log in to view pricing. False
    Cali-Curl Bond Therapy Mist 8 Fl. Oz.

    Bond Therapy Mist

    8 Fl. Oz.

    SKU 12313

    Quick View
  • 131026 12308 12308 1 Cleansing Shampoo Liter Cali-Curl Cali-Curl Cleansing Shampoo Liter False calicurl/calicurlcleansingshampooliter.jpg Bonus Deal Available 30.00 30.00 30.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Cleansing Shampoo is a gentle yet effective cleansing shampoo that removes excess buildup from styling products, the environment and chemicals while maintaining the health of the hair.

    True Log in to view pricing. False
    Cali-Curl Cleansing Shampoo Liter

    Cleansing Shampoo


    SKU 12308

    Quick View
  • 130986 12307 12307 1 Foam Diffuser Rings - Large 12 pc. Cali-Curl Cali-Curl Foam Diffuser Rings - Large 12 pc. False calicurl/calicurlfoamringslarge.jpg Bonus Deal Available 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Foam Diffuser Rings - Large are specifically designed to use with the Cali-Curl Beach Wave System to hold the hair in place and yield perfectly shaped ends.

    True Log in to view pricing. False
    Cali-Curl Foam Diffuser Rings - Large 12 pc.

    Foam Diffuser Rings - Large

    12 pc.

    SKU 12307

    Quick View
  • 130983 12306 12306 1 Foam Diffuser Rings - Medium/Medium+ 12 pc. Cali-Curl Cali-Curl Foam Diffuser Rings - Medium/Medium+ 12 pc. False calicurl/calicurlmediumfoamrings.jpg Bonus Deal Available 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Foam Diffuser Rings - Medium/Medium+ are specifically designed to use with the Cali-Curl Beach Wave System to hold the hair in place and yield perfectly shaped ends.

    True Log in to view pricing. False
    Cali-Curl Foam Diffuser Rings - Medium/Medium+ 12 pc.

    Foam Diffuser Rings - Medium/Medium+

    12 pc.

    SKU 12306

    Quick View
  • 130979 12305 12305 1 Foam Diffuser Rings - Small 12 pc. Cali-Curl Cali-Curl Foam Diffuser Rings - Small 12 pc. False calicurl/calicurlsmallfoamrollers.jpg Bonus Deal Available 12.00 12.00 12.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Foam Diffuser Rings - Small are specifically designed to use with the Cali-Curl Beach Wave System to hold the hair in place and yield perfectly shaped ends.

    True Log in to view pricing. False
    Cali-Curl Foam Diffuser Rings - Small 12 pc.

    Foam Diffuser Rings - Small

    12 pc.

    SKU 12305

    Quick View
  • 131042 12320 12320 1 Get Elevated Intro 46 pc. Cali-Curl Cali-Curl Get Elevated Intro 46 pc. False calicurl/calicurlelevatedintro.jpg Bonus Deal Available 662.00 662.00 662.00 False False False 0.00 False False Diversion contract is required 0 Cali-Curl Get Elevated Intro includes system, rings, shampoo, conditioner, mist, mask and serum.  True Log in to view pricing. False
    Cali-Curl Get Elevated Intro 46 pc.

    Get Elevated Intro

    46 pc.

    SKU 12320

    Quick View
(18 Items)