skin & body skin care

39292 111252 111252 1 daily superfoliant 2 Fl. Oz. Dermalogica Dermalogica age smart daily superfoliant 2 Fl. Oz. True dermalogica/111252dermalogicadailysuperfolianttube.jpg Special Offer Available 41.06 41.06 41.06 False True False False 41.06 False False Diversion contract is required Dermalogica age smart daily superfoliant is a resurfacing, anti-pollution powder exfoliant. This highly-active resurfacer delivers your smoothes skin ever, and helps fight the biochemical and environmental triggers known to accelerate skin aging. True Log in to view pricing. False

19278 110716 110716 1 multivitamin power recovery masque 2.5 Fl. Oz. Dermalogica Dermalogica age smart multivitamin power recovery masque 2.5 Fl. Oz. True dermalogica/110716dermalogicamultivitaminpowerrecoverymasquetube.jpg Special Offer Available 41.06 41.06 41.06 False True False False 41.06 False False Diversion contract is required Dermalogica age smart multivitamin power recovery masque is a nutrient-rich mask that helps skin recover from damage that leads to aging. True Log in to view pricing. False

58691 111341 111341 1 biolumin-c serum 1 Fl. Oz. Dermalogica Dermalogica biolumin-c serum 1 Fl. Oz. True dermalogica/111341dermalogicabiolumincserumtube.jpg Special Offer Available 58.91 58.91 58.91 False True False False 58.91 False False Diversion contract is required Dermalogica biolumin-c serum is a high performance serum works with skin's own defenses to brighten and firm. True Log in to view pricing. False

141352 111465 111465 1 retinol serum 1 Fl. Oz. Dermalogica Dermalogica dynamic skin retinol serum 1 Fl. Oz. True dermalogica/dermalogicadynamicskinretinolserum1oz.jpg Special Offer Available 58.91 58.91 58.91 False True False False 58.91 False False Diversion contract is required Dermalogica's dynamic skin retinol serum is a high-dose, fast-acting multi-retinoid with booster technology that helps reverse the appearance of wrinkles, retexturize skin and minimize the appearance of pores, and even skin tone. False Log in to view pricing. False

175784 111518 111518 1 phyto nature e² 3.4 Fl. Oz. Dermalogica Dermalogica phyto nature e² 3.4 Fl. Oz. True dermalogica/dermalogica3.4ozphytonaturee2.jpg Special Offer Available 94.01 94.01 94.01 False True False False 94.01 False False Diversion contract is required dermalogica phyto nature e² is a regenerative exosome and enzyme formula resurfaces to accelerate cellular renewal, supporting the skin's natural surface renewal process diminished by aging. True Log in to view pricing. False

156435 111487 111487 1 phyto nature lifting eye cream 0.5 Fl. Oz. Dermalogica Dermalogica phyto nature lifting eye cream 0.5 Fl. Oz. True dermalogica/dermologica-phytonatureliftingeyecream0.5oz.jpg Special Offer Available 73.78 73.78 73.78 False True False False 73.78 False False Diversion contract is required Dermalogica phyto nature lifting eye cream is a firming + lifting eye treatment. True Log in to view pricing. False

177908 111519 111519 1 pro-collagen banking water cream 1.7 Fl. Oz. Dermalogica Dermalogica pro-collagen banking water cream 1.7 Fl. Oz. True dermalogica/ma26dermalogicapro-collagenbankingwatercream1.7oz.jpg Special Offer Available 45.22 45.22 45.22 False True Valid Thru 03/31/26 False False 45.22 False False Diversion contract is required dermalogica pro-collagen banking water cream is an intensely hydrating water cream helps plump and preserve collagen and elastin, supporting skin’s resilience and barrier strength for visible bounce – now and into the future. True Log in to view pricing. False

67732 111323 111323 1 skin smoothing cream 3.4 Fl. Oz. Dermalogica Dermalogica skin smoothing cream 3.4 Fl. Oz. True dermalogica/111323dermalogicaskinsmoothingcreamtube.jpg Special Offer Available 49.39 49.39 49.39 False True False False 49.39 False False Diversion contract is required Now with a continuous 48 hours of hydration, skin smoothing cream with Active Hydramesh Technology improves skin hydration by 80%, protects against environmental factors, and locks in moisture. True Log in to view pricing. False

50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimni™ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False