MarApr26 Promos

skin & body skin care

(20 Items)
  • 50655 921552 921552 1 Nimni Day Cream 1 Fl. Oz. HydroPeptide HydroPeptide Nimni Day Cream 1 Fl. Oz. False hydropeptide/hypnewretailpackagingnimnidaycream1ozupdate.jpg Special Offer Available 49.50 49.50 49.00 True True False False 49.00 False False Diversion contract is required HydroPeptide Nimni Day Cream is a patented anti-aging booster cream that's formulated with one-of-a-kind Nimniâ„¢ Technology to visibly improve the look of fine lines and wrinkles. True Log in to view pricing. False
    HydroPeptide Nimni Day Cream 1 Fl. Oz.

    HydroPeptide
    Nimni Day Cream

    1 Fl. Oz.

    SKU 921552

    Bonus Offer
    Promotional ItemLog in to view pricing.
    Quick View
  • 39528 920116 920116 1 Aquaboost 1 Fl. Oz. HydroPeptide HydroPeptide Aquaboost 1 Fl. Oz. False hydropeptide/newhypaquaboost1oz.jpg Special Offer Available 34.50 34.50 34.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Aquaboost is a lightweight, oil-free moisturizer is thoughtfully formulated for oily and acne-prone skin. True Log in to view pricing. False
    HydroPeptide Aquaboost 1 Fl. Oz.

    HydroPeptide
    Aquaboost

    1 Fl. Oz.

    SKU 920116

    Bonus Offer
    Quick View
  • 39540 920114 920114 1 Clarifying Toner 60 pk. HydroPeptide HydroPeptide Clarifying Toner 60 pk. False hydropeptide/newhypclarifyingtoner60pk.jpg Special Offer Available 24.50 24.50 24.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Clarifying Toner are pre-soaked toner pads that help keep skin clear from blemishes while visibly brightening, smoothing uneven texture, and reducing inflammation. True Log in to view pricing. False
    HydroPeptide Clarifying Toner 60 pk.

    HydroPeptide
    Clarifying Toner

    60 pk.

    SKU 920114

    Bonus Offer
    Quick View
  • 168695 921537 921537 1 Collagen ReActivate PM 1 Fl. Oz. HydroPeptide HydroPeptide Collagen ReActivate PM 1 Fl. Oz. False hydropeptide/hydropeptidecollagenreactivatepm1oz.jpg Special Offer Available 68.00 68.00 68.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Collagen ReActivate PM features NIMNI™ Technology which reactivates collagen production while retinol and vitamin C visibly improve the signs of aging. False Log in to view pricing. False
    HydroPeptide Collagen ReActivate PM 1 Fl. Oz.

    HydroPeptide
    Collagen ReActivate PM

    1 Fl. Oz.

    SKU 921537

    Bonus Offer
    Quick View
  • 40023 920107 920107 1 Eye Authority 0.5 Fl. Oz. HydroPeptide HydroPeptide Eye Authority 0.5 Fl. Oz. True hydropeptide/newhypeyeauthority0.5oz.jpg Special Offer Available 41.50 41.50 41.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Eye Authority is a lightweight, universal cream that instantly illuminates the delicate eye area for an immediate bright-eyed boost. True Log in to view pricing. False
    HydroPeptide Eye Authority 0.5 Fl. Oz.

    HydroPeptide
    Eye Authority

    Bonus Offer
    View Sizes
  • 39549 920105 920105 1 Face Lift 1 Fl. Oz. HydroPeptide HydroPeptide Face Lift 1 Fl. Oz. True hydropeptide/newhypfacelift1oz.jpg Special Offer Available 41.50 41.50 41.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Face Lift is an advanced, ultra-light moisturizer that reinforces skin's defenses while protecting against environmental stressors, reducing the appearance of age spots, restoring youthful firmness, and visibly improving overall skin health. True Log in to view pricing. False
    HydroPeptide Face Lift 1 Fl. Oz.

    HydroPeptide
    Face Lift

    Bonus Offer
    View Sizes
  • 89486 921278 921278 1 Firma-Bright 20% Vitamin C Booster 1 Fl. Oz. HydroPeptide HydroPeptide Firma-Bright 20% Vitamin C Booster 1 Fl. Oz. False hydropeptide/newhypfirmabright1oz.jpg Special Offer Available 66.50 66.50 66.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Firma-Bright 20% Vitamin C Booster with a potent dose of stabilized vitamin C, free radical-fighting antioxidants, and radiance-boosting peptides goes above and beyond brightening to visibly firm, sculpt, and illuminate skin. True Log in to view pricing. False
    HydroPeptide Firma-Bright 20% Vitamin C Booster 1 Fl. Oz.

    HydroPeptide
    Firma-Bright 20% Vitamin C Booster

    1 Fl. Oz.

    SKU 921278

    Bonus Offer
    Quick View
  • 68068 921235 921235 1 Firm-a-Fix Neck Nectar 1.7 Fl. Oz. HydroPeptide HydroPeptide Firm-a-Fix Neck Nectar 1.7 Fl. Oz. False hydropeptide/newhypfirmafixnectar1.7oz.jpg Special Offer Available 60.00 60.00 60.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Firma-Fix Neck Nectar is designed specifically for use on your neck and décolleté. True Log in to view pricing. False
    HydroPeptide Firm-a-Fix Neck Nectar 1.7 Fl. Oz.

    HydroPeptide
    Firm-a-Fix Neck Nectar

    1.7 Fl. Oz.

    SKU 921235

    Bonus Offer
    Quick View
  • 39559 920103 920103 1 Hydrostem 1 Fl. Oz. HydroPeptide HydroPeptide Hydrostem 1 Fl. Oz. False hydropeptide/newhyphydrostem1oz.jpg Special Offer Available 84.00 84.00 84.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Hydrostem is a powerful age-defying treatment that unites regenerative peptides with plant extracts that guard against DNA damage from UV and pollution. False Log in to view pricing. False
    HydroPeptide Hydrostem 1 Fl. Oz.

    HydroPeptide
    Hydrostem

    1 Fl. Oz.

    SKU 920103

    Bonus Offer
    Quick View
  • 39571 920121 920121 1 Lumapro-C 1 Fl. Oz. HydroPeptide HydroPeptide Lumapro-C 1 Fl. Oz. True hydropeptide/newhyplumapro-c1oz.jpg Special Offer Available 74.50 74.50 74.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Lumapro-C is a spot-fading serum powered by a highly stable form of antioxidant-rich vitamin C that diminishes the appearance of existing hyperpigmentation while enhancing overall brightness to achieve ultimate radiance, clarity, and skin refinement. False Log in to view pricing. False
    HydroPeptide Lumapro-C 1 Fl. Oz.

    HydroPeptide
    Lumapro-C

    Bonus Offer
    View Sizes
  • 152728 921454 921454 1 Lumifirm Radiant Tightening Lotion 6.76 Fl. Oz. HydroPeptide HydroPeptide Lumifirm Radiant Tightening Lotion 6.76 Fl. Oz. False hydropeptide/newhyplumifirm6.76oz.jpg Special Offer Available 29.50 29.50 29.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Lumifirm Radiant Tightening Lotion is enriched with firming peptides, brightening niacinamide, and barrier-repairing biotin and ceramides. True Log in to view pricing. False
    HydroPeptide Lumifirm Radiant Tightening Lotion 6.76 Fl. Oz.

    HydroPeptide
    Lumifirm Radiant Tightening Lotion

    6.76 Fl. Oz.

    SKU 921454

    Bonus Offer
    Quick View
  • 160602 921492 921492 1 Micro-Dose Glow Booster 1 Fl. Oz. HydroPeptide HydroPeptide Micro-Dose Glow Booster 1 Fl. Oz. True hydropeptide/newhydropeptidemicrodoseglowbooster1oz.jpg Special Offer Available 41.00 41.00 41.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Micro-Dose Glow Booster features proprietary CellRenew-16 peptide technology and an advanced triple retinoid complex. True Log in to view pricing. False
    HydroPeptide Micro-Dose Glow Booster 1 Fl. Oz.

    HydroPeptide
    Micro-Dose Glow Booster

    Bonus Offer
    View Sizes
  • 160604 921493 921493 1 Micro-Dose Glow Booster TESTER 1 Fl. Oz. HydroPeptide HydroPeptide Micro-Dose Glow Booster TESTER 1 Fl. Oz. False hydropeptide/hydropeptidemicrodoseglowbooster.jpg Special Offer Available 16.50 16.50 16.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Micro-Dose Glow Booster features proprietary CellRenew-16 peptide technology and an advanced triple retinoid complex. False Log in to view pricing. False
    HydroPeptide Micro-Dose Glow Booster TESTER 1 Fl. Oz.

    HydroPeptide
    Micro-Dose Glow Booster TESTER

    1 Fl. Oz.

    SKU 921493

    Bonus Offer
    Quick View
  • 51029 920254 920254 1 Miracle Mask 0.5 Fl. Oz. HydroPeptide HydroPeptide Miracle Mask 0.5 Fl. Oz. True hydropeptide/hydropeptidemiraclemask.jpg Special Offer Available 24.00 24.00 24.00 False False False False 0.00 False False Diversion contract is required HydroPeptide Miracle Mask uses purifying clays to clear impurities while minimizing the appearance of pores, while peptides address the appearance of wrinkles and an advanced complex provides an immediate visible lift. True Log in to view pricing. False
    HydroPeptide Miracle Mask 0.5 Fl. Oz.

    HydroPeptide
    Miracle Mask

    Bonus Offer
    View Sizes
  • 39589 920118 920118 1 Polish & Plump Peel 2 pc. HydroPeptide HydroPeptide Polish & Plump Peel 2 pc. False hydropeptide/hypnewpolishplump2pc.jpg Special Offer Available 44.50 44.50 44.50 False False False False 0.00 False False Diversion contract is required HydroPeptide Polish & Plump Peel provides the benefits of a gentle microdermabrasion, a light chemical peel and a pampering facial in just two easy steps. True Log in to view pricing. False
    HydroPeptide Polish & Plump Peel 2 pc.

    HydroPeptide
    Polish & Plump Peel

    2 pc.

    SKU 920118

    Bonus Offer
    Quick View
(20 Items)