travel/minis skin & body

(36 Items)

19327 611596 611596 4 active moist SAMPLE Dermalogica Dermalogica active moist SAMPLE dermalogica/611596dermalogicaactivemoisttube.jpg Bonus Deal Available 0.20 0.28 0.28 False False False False 0.00 False False Diversion contract is required 0 Dermologica active moist is a light, oil-free lotion that helps improve skin texture and combat surface dehydration. True Log in to view pricing. False

Dermalogica
active moist

SAMPLE

SKU 611596

Log in to view pricing.
Quick View
135602 611449 611449 1 awaken peptide eye gel SAMPLE Dermalogica Dermalogica awaken peptide eye gel SAMPLE dermalogica/dermalogicaawakenpeptideeyegelsample.jpg Bonus Deal Available 0.50 0.70 0.70 False False False False 0.00 False False Diversion contract is required 0 Dermalogica awaken peptide eye gel is a firming, hydrating eye gel with caffeine utilizes a highly active blend with Tetrapeptides and soothing Rosemary Leaf Extract that minimizes the appearance of puffiness and fine lines. True Log in to view pricing. False

Dermalogica
awaken peptide eye gel

SAMPLE

SKU 611449

Log in to view pricing.
Quick View
130309 611455 611455 1 Circular Hydration Serum Sample 0.03 Fl. Oz. Dermalogica Dermalogica Circular Hydration Serum Sample 0.03 Fl. Oz. dermalogica/dermalogicacircularhydrationserumsample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica circular hydration serum immediately floods skin with hydration, replenishes from within, and helps prevent future hydration evaporation. False Log in to view pricing. False

Dermalogica
Circular Hydration Serum Sample

0.03 Fl. Oz.

SKU 611455

Log in to view pricing.
Quick View
120828 611439 611439 1 daily glycolic cleanser SAMPLE Dermalogica Dermalogica daily glycolic cleanser SAMPLE dermalogica/demalogicadailyglycoliccleansersample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica daily glycolic cleanser is a brightening and conditioning cleanser that renews dull, uneven skin tone and helps remove buildup caused by environmental factors. True Log in to view pricing. False

Dermalogica
daily glycolic cleanser

SAMPLE

SKU 611439

Log in to view pricing.
Quick View
19307 111248 111248 1 daily microfoliant - travel bright 0.45 Fl. Oz. Dermalogica Dermalogica daily microfoliant - travel bright 0.45 Fl. Oz. dermalogica/dermalogicadailymicrofoliant045oz.jpg Bonus Deal Available 9.00 12.60 12.60 False False False False 0.00 False False Diversion contract is required 0 Dermalogica daily microfoliant is a gentle, daily use exfoliating powder that sloughs away dead skin cells, instantly leaving skin smoother and brighter. For use with all skin conditions. True Log in to view pricing. False

Dermalogica
daily microfoliant - travel bright

0.45 Fl. Oz.

SKU 111248

Log in to view pricing.
Quick View
133384 411453 411453 1 daily milkfoliant 0.45 Fl. Oz. Dermalogica Dermalogica daily milkfoliant 0.45 Fl. Oz. dermalogica/dermalogicadailymilkfoliant045oz.jpg Bonus Deal Available 9.00 12.60 12.60 False False False False 0.00 False False Diversion contract is required 0 Make peace with daily exfoliation. Dermalogica's daily milkfoliant exfoliator gently polishes to reveal smoother, more vibrant skin, replenishes and restores skin's moisture barrier and relieves skin with calming and soothing ingredients. True Log in to view pricing. False

Dermalogica
daily milkfoliant

0.45 Fl. Oz.

SKU 411453

Log in to view pricing.
Quick View
141352 611465 611465 1 retinol serum SAMPLE Dermalogica Dermalogica dynamic skin retinol serum SAMPLE dermalogica/dermalogicadynamicskinretinolserumsample.jpg Bonus Deal Available 0.70 0.98 0.98 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's dynamic skin retinol serum is a high-dose, fast-acting multi-retinoid with booster technology that helps reverse the appearance of wrinkles, retexturize skin and minimize the appearance of pores, and even skin tone. True Log in to view pricing. False

Dermalogica
dynamic skin retinol serum

SAMPLE

SKU 611465

Log in to view pricing.
Quick View
145276 911474-10 911474-10 1 oil to foam total cleanser 0.5 Fl. Oz. Dermalogica Dermalogica oil to foam total cleanser 0.5 Fl. Oz. dermalogica/dermalogicaoiltofoamtotalcleanser05oz.jpg Bonus Deal Available 6.00 8.40 8.40 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. True Log in to view pricing. False

Dermalogica
oil to foam total cleanser

0.5 Fl. Oz.

SKU 911474-10

Log in to view pricing.
Quick View
145276 611474 611474 1 oil to foam total cleanser SAMPLE Dermalogica Dermalogica oil to foam total cleanser SAMPLE dermalogica/dermalogicaoiltofoamtotalcleansersample.jpg Bonus Deal Available 0.60 0.84 0.84 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's oil to foam total cleanser is an all-in-one cleanser that removes make-up and sunscreen while also cleansing skin, leaving it feeling instantly soft and smooth. True Log in to view pricing. False

Dermalogica
oil to foam total cleanser

SAMPLE

SKU 611474

Log in to view pricing.
Quick View
144615 611466 611466 1 phyto nature oxygen liquid cream 0.07 Fl. Oz. Dermalogica Dermalogica phyto nature oxygen liquid cream 0.07 Fl. Oz. dermalogica/dermalogicaphytonatureoxygencreamsample.jpg Bonus Deal Available 0.40 0.56 0.56 False False False False 0.00 False False Diversion contract is required 0 Dermalogica's phyto nature oxygen cream is a reawakening daily liquid moisturizer that firms, lifts, and revitalizes with premium hydrating and oxygen-optimizing phytoactives. True Log in to view pricing. False

Dermalogica
phyto nature oxygen liquid cream

0.07 Fl. Oz.

SKU 611466

Log in to view pricing.
Quick View
67732 111325 111325 1 skin smoothing cream 0.5 Fl. Oz. Dermalogica Dermalogica skin smoothing cream 0.5 Fl. Oz. dermalogica/111325dermalogicaskinsmoothingcreamtube.jpg Bonus Deal Available 8.50 11.90 11.90 False False False False 0.00 False False Diversion contract is required 0 Now with a continuous 48 hours of hydration, skin smoothing cream with Active Hydramesh Technology improves skin hydration by 80%, protects against environmental factors, and locks in moisture. True Log in to view pricing. False

Dermalogica
skin smoothing cream

0.5 Fl. Oz.

SKU 111325

Log in to view pricing.
Quick View
122120 29444 29444 1 Moisture Lotion Hand & Body Cream 1.7 Fl. Oz. ELEVEN Australia ELEVEN Australia Moisture Lotion Hand & Body Cream 1.7 Fl. Oz. elevenaustralia/elevenaustraliamoisturelotionhandandbodycream17floz.jpg Bonus Deal Available 4.50 4.50 4.50 False False False False 0.00 False False Diversion contract is required 0 ELEVEN Australia Moisture Lotion Hand & Body Cream is a moisturizing blend of aloe and organic cucumber to hydrate the skin True Log in to view pricing. False

ELEVEN Australia
Moisture Lotion Hand & Body Cream

1.7 Fl. Oz.

SKU 29444

Log in to view pricing.
Quick View
122122 29443 29443 1 Wash Me All Over Hand & Body Wash 1.7 Fl. Oz. ELEVEN Australia ELEVEN Australia Wash Me All Over Hand & Body Wash 1.7 Fl. Oz. elevenaustralia/elevenaustraliawashmealloverhandandbodywash17floz.jpg Bonus Deal Available 4.50 4.50 4.50 False False False False 0.00 False False Diversion contract is required 0 ELEVEN Australia Wash Me All Over Hand & Body Wash is a SLS free formula with a blend of papaya, jojoba oil and sweet almond oil. True Log in to view pricing. False

ELEVEN Australia
Wash Me All Over Hand & Body Wash

1.7 Fl. Oz.

SKU 29443

Log in to view pricing.
Quick View
84664 921296 921296 1 Cashmere Cleanse Travel 1.6 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Cashmere Cleanse Travel 1.6 Fl. Oz. hydropeptide/cashmerecleansetravel2.jpg Bonus Deal Available 8.00 8.00 8.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Cashmere Cleanse Facial Rose Milk is a comforting cleanser that gently whisks away daytime impurities without stripping or drying the skin. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore Cashmere Cleanse Travel

1.6 Fl. Oz.

SKU 921296

Log in to view pricing.
Quick View
84669 921255 921255 1 Hydro-Lock Sleep Mask 2.53 Fl. Oz. HydroPeptide HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask 2.53 Fl. Oz. hydropeptide/hphydrolocksleepmask.jpg Bonus Deal Available 44.00 44.00 44.00 False False False False 0.00 False False Diversion contract is required 0 HydroPeptide Anti-Wrinkle + Restore Hydro-Lock Sleep Mask Royal Peptide Treatment is a luxurious sleeping mask that blankets the contours of skin with a layer of intense, restorative hydration. True Log in to view pricing. False

HydroPeptide
Anti-Wrinkle + Restore Hydro-Lock Sleep Mask

2.53 Fl. Oz.

SKU 921255

Log in to view pricing.
Quick View