hair care dry shampoo

(21 Items)

50551 260014 260014 1 perk up dry shampoo 5.3 Fl. Oz. amika: amika: perk up dry shampoo 5.3 Fl. Oz. True amika/amikanewperkupdryshampoo53floz.jpg Bonus Deal Available 16.00 16.00 13.60 True True False False 13.60 False False Diversion contract is required 0 amika: talc-free dry shampoo absorbs oil, reduces odor, and gives hair a freshly washed look without a trace of white residue, all while restoring 'oomph'. True Log in to view pricing. False

amika:
perk up dry shampoo

Promotional ItemLog in to view pricing.
View Sizes
137640 260382 260382 1 perk up plus extended clean dry shampoo 5.3 Fl. Oz. amika: amika: perk up plus extended clean dry shampoo 5.3 Fl. Oz. True amika/amikaperkupplusextendedcleandryshampoo5oz.jpg Bonus Deal Available 17.50 17.50 14.88 True True False False 14.88 False False Diversion contract is required 0 amika: perk up plus extended clean dry shampoo is meant for day 4-5 hair, whether you skipped a much-needed wash day or just hit the gym. True Log in to view pricing. False

amika:
perk up plus extended clean dry shampoo

Promotional ItemLog in to view pricing.
View Sizes
155619 260460 260460 1 perk up ultra oil control dry shampoo 5.3 Fl. Oz. amika: amika: perk up ultra oil control dry shampoo 5.3 Fl. Oz. False amika/amikaperkupultradryshampoo5.3oz.jpg Bonus Deal Available 17.50 17.50 14.88 True True False False 14.88 False False Diversion contract is required 0 amika: perk up ultra oil control dry shampoo is clinically proven to remove oil. True Log in to view pricing. False

amika:
perk up ultra oil control dry shampoo

5.3 Fl. Oz.

SKU 260460

Promotional ItemLog in to view pricing.
Quick View
93489 29026 29026 1 Dry Shampoo Volume Paste 3 Fl. Oz. ELEVEN Australia ELEVEN Australia Dry Shampoo Volume Paste 3 Fl. Oz. False elevenaustralia/elevenausdryshampoovolumepaste3oz.jpg Bonus Deal Available 12.50 12.50 10.63 True True False False 10.63 False False Diversion contract is required 0 ELEVEN Australia Dry Shampoo Volume Paste is a reworkable paste that provides hair with root lift and second day texture with a natural finish. True Log in to view pricing. False

ELEVEN Australia
Dry Shampoo Volume Paste

3 Fl. Oz.

SKU 29026

Promotional ItemLog in to view pricing.
Quick View
45459 29175 29175 1 Give Me Clean Hair Dry Shampoo 3.5 Fl. Oz. ELEVEN Australia ELEVEN Australia Give Me Clean Hair Dry Shampoo 3.5 Fl. Oz. False elevenaustralia/elevengmchdryshampoospray3oz.jpg Bonus Deal Available 12.50 12.50 10.63 True True False False 10.63 False False Diversion contract is required 0 ELEVEN Australia Give Me Clean Hair Dry Shampoo refreshes hair and removes oil. True Log in to view pricing. False

ELEVEN Australia
Give Me Clean Hair Dry Shampoo

3.5 Fl. Oz.

SKU 29175

Promotional ItemLog in to view pricing.
Quick View
80830 127409 127409 1 Dry Shampoo N°11 6.5 Fl. Oz. Keune Keune Style Refresh Dry Shampoo N°11 6.5 Fl. Oz. False keune/keunestylerefreshddryshampoon116oz.jpg Bonus Deal Available 12.20 12.20 10.37 True True False False 10.37 False False Diversion contract is required 0 Extend your style and refresh your roots with Keune Style Refresh Dry Shampoo N°11. True Log in to view pricing. False

Keune
Style Refresh Dry Shampoo N°11

6.5 Fl. Oz.

SKU 127409

Promotional ItemLog in to view pricing.
Quick View
18780 110175 110175 1 DOO.OVER 8.45 Fl. Oz. KEVIN.MURPHY KEVIN.MURPHY DOO.OVER 8.45 Fl. Oz. True kevinmurphy/km_doo-over_8-45oz.jpg Bonus Deal Available 19.00 19.00 16.15 True True False False 16.15 False False Diversion contract is required 0 Want a ‘doo’ that packs volume and hold, but with a softer look and feel…KEVIN.MURPHY DOO.OVER is everything you desire and yet so much more – it’s a ‘hair-doo’ in a can! True Log in to view pricing. False

KEVIN.MURPHY
DOO.OVER

Promotional ItemLog in to view pricing.
View Sizes
715 100029 100029 1 FRESH.HAIR 8.45 Fl. Oz. KEVIN.MURPHY KEVIN.MURPHY FRESH.HAIR 8.45 Fl. Oz. True kevinmurphy/km_fresh-hair_8-45oz.jpg Bonus Deal Available 17.50 17.50 14.88 True True False False 14.88 False False Diversion contract is required 0 KEVIN.MURPHY FRESH.HAIR, a hardworking dry shampoo, that instantly freshens and deodorises to transform hair back to fresh, bouncy locks – it’s the ideal way to boost hair having a midday meltdown. True Log in to view pricing. False

KEVIN.MURPHY
FRESH.HAIR

Promotional ItemLog in to view pricing.
View Sizes
68661 69095 69095 1 Dry Shampoo 4.4 Fl. Oz. LOMA LOMA Dry Shampoo 4.4 Fl. Oz. False loma/lomadryshampoo200mlnewpackaging.jpg Bonus Deal Available 13.51 13.51 11.48 True True False False 11.48 False False Diversion contract is required 0 LOMA Dry Shampoo is rich with Aloemoist Complex, as well as rice and tapioca starch for better absorption of oils and other impurities. True Log in to view pricing. False

LOMA
Dry Shampoo

4.4 Fl. Oz.

SKU 69095

Promotional ItemLog in to view pricing.
Quick View
131483 57765 57765 1 Refreshing Dry Shampoo 5.6 Fl. Oz. Milbon Milbon Signature CREATIVE STYLE Refreshing Dry Shampoo 5.6 Fl. Oz. True milbon/milboncreativestylerefreshingdryshampoo5ozupdate.jpg Bonus Deal Available 17.50 17.50 14.88 True True False False 14.88 False True Diversion contract is required 0 Milbon Signature CREATIVE STYLE Refreshing Dry Shampoo features unique deodorizing technology that actually eliminates scalp odor rather than simply masking it, leaving a delightful scent of green apple and muguet (lily of the valley). True Log in to view pricing. False

Milbon
Signature CREATIVE STYLE Refreshing Dry Shampoo

Promotional ItemLog in to view pricing.
View Sizes
109647 780779 780779 1 Clear Invisible Dry Shampoo 1.5 Fl. Oz. UNITE UNITE U:DRY Clear Invisible Dry Shampoo 1.5 Fl. Oz. True unite/uniteudrycleardryshampoo1oztravel.jpg Bonus Deal Available 8.00 8.00 6.80 True True False False 6.80 False False Diversion contract is required 0 IN THE CLEAR On-the-go or just a quick touch up, the answer is clear – UNITE'S U:DRY™ Clear dry shampoo keeps natural oils in check, plus neutralizes odor, leaving styles refreshed, reset, and residue-free. True Log in to view pricing. False

UNITE
U:DRY Clear Invisible Dry Shampoo

Promotional ItemLog in to view pricing.
View Sizes
95911 780711 780711 1 High Volumizing Dry Shampoo 6.7 Fl. Oz. UNITE UNITE U:DRY High Volumizing Dry Shampoo 6.7 Fl. Oz. True unite/unitehighvolumizingdryshampoo6oz.jpg Bonus Deal Available 17.25 17.25 14.66 True True False False 14.66 False False Diversion contract is required 0 HIGH & DRY Turn the volume on high with UNITE'S U:DRY™ High, a volumizing, translucent dry shampoo that quickly absorbs oils plus adds instant volume & texture. Perfect for fine oily hair, or lifeless dirty hair. U:DRY™ High has got you and your oil covered. True Log in to view pricing. False

UNITE
U:DRY High Volumizing Dry Shampoo

Promotional ItemLog in to view pricing.
View Sizes
95906 780712 780712 1 Plus+ Extra Absorbing Dry Shampoo 5 Fl. Oz. UNITE UNITE U:DRY Plus+ Extra Absorbing Dry Shampoo 5 Fl. Oz. True unite/unitedryplusextraabsorbingdryshampoo5oz.jpg Bonus Deal Available 17.25 17.25 14.66 True True False False 14.66 False False Diversion contract is required 0 SO EXTRA Don’t be afraid to go the extra mile with UNITE'S U:DRY™ Plus+ extra absorbing, residue-free, dry shampoo. It’s heavy-duty, yet lightweight formula diffuses evenly onto roots leaving hair fresh and clean with lots of movement. With U:DRY™ Plus+ go straight from the gym to out on the town – just shake, spray and be extra. True Log in to view pricing. False

UNITE
U:DRY Plus+ Extra Absorbing Dry Shampoo

Promotional ItemLog in to view pricing.
View Sizes
154513 883195 883195 1 FRESH.HAIR TRIAL & TRAVEL KI 2 pc. KEVIN.MURPHY KEVIN.MURPHY FRESH.HAIR TRIAL & TRAVEL KI 2 pc. False kevinmurphy/kevinmurphyfreshhairtrialandtravelkit.jpg Bonus Deal Available 17.50 17.50 17.50 False True Valid Thru 04/30/24 False False 0.00 False False Diversion contract is required 0 KEVIN.MURPHY FRESH.HAIR TRIAL & TRAVEL KIT includes retail and mini size of dry shampoo.
Purchase:
1 FRESH.HAIR 8.45 oz.
Receive FREE:
1 FRESH.HAIR 3.4 oz. True Log in to view pricing. False

KEVIN.MURPHY
FRESH.HAIR TRIAL & TRAVEL KI

2 pc.

SKU 883195

Promotional ItemLog in to view pricing.
Quick View
18752 91026 91026 1 dry cleaning mist 5.07 Fl. Oz. Davines Davines Hair Refresher dry cleaning mist 5.07 Fl. Oz. False davines/davineshairrefresher507floz.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required 0 Davines Hair Refresher dry cleansing mist is a cleansing dry shampoo spray to refresh and clean hair without using water. False Log in to view pricing. False

Davines
Hair Refresher dry cleaning mist

5.07 Fl. Oz.

SKU 91026

Log in to view pricing.
Quick View